Vibrio antiquarius: VEA_001752 Help Entry VEA_001752        CDS       T01107                                  Name (GenBank) hypothetical protein   KO K09892   cell division protein ZapB Organism vex  Vibrio antiquarius Brite KEGG Orthology (KO) [BR:vex00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:vex03036]     VEA_001752 Chromosome and associated proteins [BR:vex03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     VEA_001752 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB PspA_IM30 Nuf2_DHR10-like YabA Dor1 DUF7237 Alanine_zipper Syntaxin DUF7491 APG6_N DUF2203 Spc7 Dynamin-like_hel_bact ApoLp-III Ax_dynein_light Tup_N THOC7 ERM_helical NPV_P10 Muted Sec10_N DUF4337 Herpes_UL6 HAUS-augmin3 NET2A DGCcoil DUF3450 Mod_r DUF6549 MctB TMF_TATA_bd Leu_zip betaPIX_CC COG3_N DUF948 Occludin_ELL CsiV Prefoldin DUF4164 DUF4140 COG6_N ATG14 ToxN_toxin DUF4407 DUF3810 5_nucleotid UPF0242 Prefoldin_2 Prominin DUF1664 FapA MCU AAA_13 OmpH DivIC K-box NUDE_C PCRF Mis12 V_ATPase_I TMPIT Motif Other DBs NCBI-ProteinID:  ACY49915 LinkDB All DBs Position 1:complement(138931..139173) Genome browser AA seq 80 aa AA seqDB search MSFEVLEQLESKIQTAVDTITLLQMEVEELKEDKAKLAEEANELRSQREELEQKAQQAQQ EHAQWQERIRALLGKMDEVE NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgtcttttgaagtactagaacaactagaatctaaaattcaaactgcagttgacacaatc actcttcttcagatggaagtcgaagagctgaaagaagataaagctaaacttgcggaagaa gcgaacgagcttcgctctcaacgagaagagctagagcaaaaagcacaacaagcacagcaa gagcatgcgcaatggcaagagcgcattcgtgcactacttggcaaaatggacgaagtggaa taa

DBGET integrated database retrieval system