KEGG   Viruses: 13230767
Entry
13230767          CDS       T40000                                 

Symbol
STLV-6_gp4
Name
(RefSeq) Simian T-cell lymphotropic virus 6; tax protein
  KO
K21857  HTLV protein Tax-1
Taxonomy
TAX:481147
  Lineage
Viruses; ssRNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Deltaretrovirus; unclassified Deltaretrovirus
Organism
vg  Viruses (Simian T-cell lymphotropic virus 6)
SSDB
Motif
Pfam: Tax
Other DBs
NCBI-GeneID: 13230767
NCBI-ProteinID: YP_002308476
RS: NC_011546
UniProt: D1MNA3
LinkDB
Position
NC_011546:join(5054..5057,7232..8280)
AA seq 350 aa
MAHFPGFGQSLLYGYPVYVFGDCVQADWCPISGGLCSARLHRHALLATCPEHQITWDPID
GRVVSSPLQYLIPRLPSFPTQRTSRTLKVLTPPPTATTPKVPPSFFHAVRKHTPFRNNCL
ELTLGEQLPAMSFPDPGLRPQNVYTMWGSTIVCLYLYQLTPPMTWPLIPHVIFCHPDQLG
AFLTKIPTKRLEELLYKLFLSTGAILILPENCFPTTLFQPTRAPVIQAPWHSGLLPYLKE
IVTPGLIWVFTDGSSMISGPCPKEGQPSLVVQSSTFIFQKFQTKAYHPAFLLSHKLIQYS
SFHSLHLLFEEYTTVPFSLLFNEKEANDSDSKPQGEPQLLAKGHTVESSV
NT seq 1053 nt   +upstreamnt  +downstreamnt
atggcccactttccaggtttcgggcagagcctgctctacgggtaccctgtctacgttttc
ggcgattgtgtgcaggccgattggtgccccatttccggggggctttgttccgcccggcta
catcggcacgccttactggccacctgtcctgaacaccagatcacctgggaccccatcgat
ggacgcgttgtcagctcgcctctacaataccttatccctcgcctcccctccttccccacc
caaagaacttcccgcaccctcaaggtcctcaccccgccgcccactgctacaacccccaaa
gttcctccctccttcttccatgcagtcaggaaacacacccctttccgaaacaactgcctc
gagctcaccttgggagagcaactacccgccatgtctttccccgaccccggcctccgaccc
caaaatgtctataccatgtggggaagcaccatcgtgtgcttatacctctaccaactcaca
cctccaatgacctggccgttaatcccacatgtcattttttgccatccggaccaactaggg
gccttcctaacaaaaatccctaccaaacgcttggaagaactcttatacaaactattctta
agtacaggggccatacttatcctacctgaaaattgcttcccaactaccctgtttcagccc
acccgcgcaccagtaattcaagccccctggcactcaggcctactcccatacctaaaggaa
attgtcacccccgggctgatttgggtgtttactgacggtagttctatgatttccggaccc
tgccccaaggaagggcagccatctttggtggtccaatcatctacattcattttccaaaaa
tttcaaaccaaagcctatcacccagccttcctcctgtcccataaattaatccaatactcc
tcgttccattccctccatctactttttgaagaatacaccactgtccccttttctttattg
tttaacgaaaaagaggcaaatgacagtgacagcaagccccaaggcgagccacaactacta
gccaaagggcatacagttgaatcatctgtctag

DBGET integrated database retrieval system