KEGG   Viruses: 1487439
Entry
1487439           CDS       T40000                                 

Symbol
UL44, CeHV1gp46
Name
(RefSeq) Macacine alphaherpesvirus 1; envelope glycoprotein C
  KO
K19256  Simplexvirus envelope glycoprotein C
Taxonomy
TAX:10325 [GN:T40077]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Organism
vg  Viruses (Macacine alphaherpesvirus 1)
SSDB
Motif
Pfam: Marek_A C1-set
Other DBs
NCBI-GeneID: 1487439
NCBI-ProteinID: NP_851904
RS: NC_004812
UniProt: Q7T5D4
LinkDB
Position
NC_004812:95527..96930
AA seq 467 aa
MAGWRAAGSGLCLFVLMWLLCAGAGAPRGAASTPAGRPGASRPGGVERANRTAAPARGRG
SSNGTGPGSTSAQFRCKRPDVSALYGSRVVIGCRLPRPTADFRLQIWRVAAAAHTEPVEP
GAVLVNVTAPPDGELVYDSAPNRTEARVRWAEGAGPDARPRVYSIEGTFPTQRLVIQELT
VARQGLYLWIRGPAERPLRYGTWTRVRMLRRPSLSIRAHTVLEGEPFGATCVAANYYPGD
RAAFRWFEGGGEVVAPERVQTRVDAQRNGFSATSTLTSEARAGLAPPRNLTCEFTWHRDS
VSFSRRNATGAPTVLPRPTIEMEFGSGEAVCTAACVPEGVELQWLLGADPAPAEDAAASG
GPCPGHPGLARVRSALPLSREHSEYTCRLVGYPPTVPVLEHHGRHEPAPRDPVGQQVTTA
LEWAGIAAGSAAAIGLAVGVGVYVRRAVARRRRVRTGRWAGEPARRG
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggccgggtggcgcgccgcgggttcgggcctgtgtctgtttgtgttgatgtggttgttg
tgcgcgggcgccggcgcgccgcggggcgccgcctcgaccccggcggggcggcccggggcg
tcgcgccccggcggggtcgagcgggctaaccgcacggccgcgcccgcgcgcgggcgcggc
agcagcaacggcaccgggccgggctccacctccgcccagttccgctgcaagcgacccgac
gtgtcggcgctgtacggcagccgcgtggtcattgggtgccgcctgccgcgccccaccgcc
gacttccgcctgcagatctggcgcgtcgcggcggccgcgcacaccgagcccgtggagccg
ggggcggtgctggtgaacgtgaccgccccgcccgacggggaactggtctacgacagcgcc
cccaaccggaccgaggcgcgggtgcggtgggccgagggggcgggccccgatgcccgccct
cgggtctactcgatcgaggggaccttcccgacgcagcggctcgtcatccaggagctcacg
gtcgcgcgccaggggctgtacctctggatccgggggcccgccgagcgccccctccgctac
gggacctggacgcgggtgcgcatgctccgccggccctccctctcgatccgcgcgcacacg
gtcctcgagggcgagccgttcggggccacctgcgtggccgccaactactacccgggcgac
cgcgccgccttccgctggttcgagggcggcggcgaggtggtcgcgccggagcgggtccag
acgcgcgtcgacgcgcagcgcaacggcttttcggccacgtcgaccctgacgtccgaggcg
cgggcgggcctggcgcccccgcgcaacctcacctgcgagttcacctggcaccgcgactcg
gtgtccttctcgcgacgcaacgccaccggcgccccgacggtgctgccgcggcccacgatc
gagatggagttcgggagcggcgaggccgtctgcacggccgcctgcgttcccgagggggtg
gagctgcagtggctgctgggggccgacccggcccccgcggaggacgccgccgccagcggc
ggaccctgccccgggcacccggggctcgcccgcgtgcgctccgccctgccgctgtcgcgc
gagcacagcgagtacacctgccggctggtcggctaccccccgacggtccccgtgctggag
caccacggccgccacgagccggcgccgcgcgaccccgtgggccagcaggtgaccaccgcg
ctcgagtgggccggcatcgccgcggggtccgcggcggcgatagggctcgccgtgggcgtc
ggcgtctacgtgcggcgcgccgtcgcgaggaggcggcgggttcgcaccggccgctgggcg
ggcgaacccgcgcgtagagggtga

DBGET integrated database retrieval system