KEGG   Viruses: 1487561
Entry
1487561           CDS       T40000                                 

Symbol
ORF16, EhV1gORF16
Name
(RefSeq) Equid alphaherpesvirus 1; envelope glycoprotein C
  KO
K19256  Simplexvirus envelope glycoprotein C
Taxonomy
TAX:10326
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Varicellovirus
Organism
vg  Viruses (Equid alphaherpesvirus 1)
SSDB
Motif
Pfam: Marek_A C2-set_2 C1-set
Other DBs
NCBI-GeneID: 1487561
NCBI-ProteinID: YP_053061
RS: NC_001491
UniProt: Q6S6Q5 P68325 Q6F4H9 Q53YT2
LinkDB
Position
NC_001491:complement(21445..22851)
AA seq 468 aa
MWLPNLVRFVAVAYLICAGAILTYASGASASSSQSTPATPTHTTPNLTTAHGAGSDNTTN
ANGTESTHSHETTITCTKSLISVPYYKSVDMNCTTSVGVNYSEYRLEIYLNQRTPFSGTP
PGDEENYINHNATKDQTLLLFSTAERKKSRRGGQLGVIPDRLPKRQLFNLPLHTEGGTKF
PLTIKSVDWRTAGIYVWSLYAKNGTLVNSTSVTVSTYNAPLLDLSVHPSLKGENYRATCV
VASYFPHSSVKLRWYKNAREVDFTKYVTNASSVWVDGLITRISTVSIPVDPEEEYTPSLR
CSIDWYRDEVSFARIAKAGTPSVFVAPTVSVSVEDGDAVCTAKCVPSTGVFVSWSVNDHL
PGVPSQDMTTGVCPSHSGLVNMQSRRPLSEENGEREYSCIIEGYPDGLPMFSDTVVYDAS
PIVEDRPVLTSIIAVTCGAAALALVVLITAVCFYCSKPSQAPYKKSDF
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgtggttgcctaatctcgtgagatttgtggcggtcgcgtatctaatctgtgccggggcg
atattaacttatgcctctggagctagtgctagctccagccagagtacgcccgctacacca
actcacacaactccgaatctaactaccgcacacggcgcgggctctgacaacacaactaac
gcaaacggtacagaatctacacactcccatgaaaccacaatcacctgcaccaagagtctc
atatctgtgccctactacaaatctgtcgatatgaactgtacaacgtcggtaggcgtaaat
tatagcgagtaccgcctcgagatttacttgaaccagcgcaccccattttcgggtacgccc
cccggcgacgaagaaaactacatcaaccataacgccaccaaggatcagactctgctgtta
ttctcaacggcagagaggaaaaaatctcgaaggggtggccagctgggagttatcccagac
aggctaccaaagcgccagctgtttaaccttcccctccacacggaaggtggtacaaagttt
ccactgaccatcaaatctgtagattggcggacggccggcatttacgtgtggtccttgtat
gccaaaaatggcacgctcgttaacagtaccagcgttaccgtctcaacctacaacgcaccg
ttgctggacctttccgttcacccgagcctgaagggggaaaactacagggccacgtgcgtc
gtcgcaagctactttccacacagctccgtcaagctgcggtggtacaaaaatgcccgcgag
gtggactttacaaagtacgttacgaacgcctcaagcgtgtgggtagacgggctaatcacg
cgaatctctacggtgtctatcccggttgatccggaggaggaatacacacccagtcttcgc
tgtagcatagactggtacagggacgaagtatcatttgctcgcatagccaaagctggaaca
ccctctgtgtttgttgccccaaccgtgtccgtttcggtagaagacggagacgccgtctgt
acggctaaatgcgtaccgagcaccggggtgttcgtatcgtggtcagtgaacgaccaccta
ccaggggttccgtcgcaagacatgacaaccggagtctgccctagccactcgggattggtt
aacatgcaaagccgccggcccctctcagaagagaatggggagagggagtatagctgcata
atagaggggtaccccgacggcctgcctatgttttcggacacagtggtatatgacgcctcc
ccgattgttgaggacaggccggttttgacgagcatcatcgcagttacttgcggggccgcg
gcactggcgctggtcgttctcatcacagccgtctgtttttactgctccaagccctcacag
gcgccgtacaagaagtctgacttttag

DBGET integrated database retrieval system