KEGG   Viruses: 1489363
Entry
1489363           CDS       T40000                                 
Symbol
E1, HPV6bgp3
Name
(RefSeq) Human papillomavirus type 6b; E1
  KO
K21810  Alphapapillomavirus replication protein E1 [EC:5.6.2.-]
Virus
10600  Human papillomavirus type 6b
SSDB
Motif
Pfam: PPV_E1_C PPV_E1_DBD PPV_E1_N Parvo_NS1 DUF5906 ATPase RNA_helicase HUN
Other DBs
NCBI-GeneID: 1489363
NCBI-ProteinID: NP_040298
RS: NC_001355
UniProt: P03113 P06459
LinkDB
Position
NC_001355:832..2781
AA seq 649 aa
MADDSGTENEGSGCTGWFMVEAIVQHPTGTQISDDEDEEVEDSGYDMVDFIDDSNITHNS
LEAQALFNRQEADTHYATVQDLKRKYLGSPYVSPINTIAEAVESEISPRLDAIKLTRQPK
KVKRRLFQTRELTDSGYGYSEVEAGTGTQVEKHGVPENGGDGQEKDTGRDIEGEEHTEAE
APTNSVREHAGTAGILELLKCKDLRAALLGKFKECFGLSFIDLIRPFKSDKTTCLDWVVA
GFGIHHSISEAFQKLIEPLSLYAHIQWLTNAWGMVLLVLLRFKVNKSRSTVARTLATLLN
IPENQMLIEPPKIQSGVAALYWFRTGISNASTVIGEAPEWITRQTVIEHGLADSQFKLTE
MVQWAYDNDICEESEIAFEYAQRGDFDSNARAFLNSNMQAKYVKDCATMCRHYKHAEMRK
MSIKQWIKHRGSKIEGTGNWKPIVQFLRHQNIEFIPFLTKFKLWLHGTPKKNCIAIVGPP
DTGKSYFCMSLISFLGGTVISHVNSSSHFWLQPLVDAKVALLDDATQPCWIYMDTYMRNL
LDGNPMSIDRKHKALTLIKCPPLLVTSNIDITKEDKYKYLHTRVTTFTFPNPFPFDRNGN
AVYELSNTNWKCFFERLSSSLDIQDSEDEEDGSNSQAFRCVPGTVVRTL
NT seq 1950 nt   +upstreamnt  +downstreamnt
atggcggacgattcaggtacagaaaatgaggggtctgggtgtacaggatggtttatggta
gaagctatagtgcaacacccaacaggtacacaaatatcagacgatgaggatgaggaggtg
gaggacagtgggtatgacatggtggactttattgatgacagcaatattacacacaattca
ctggaagcacaggcattgtttaacaggcaggaggcggacacccattatgcgactgtgcag
gacctaaaacgaaagtatttaggtagtccatatgttagtcctataaacactatagccgag
gcagtggaaagtgaaataagtccacgattggacgccattaaacttacaagacagccaaaa
aaggtaaagcgacggctgtttcaaaccagggaactaacggacagtggatatggctattct
gaagtggaagctggaacgggaacgcaggtagagaaacatggcgtaccggaaaatggggga
gatggtcaggaaaaggacacaggaagggacatagagggggaggaacatacagaggcggaa
gcgcccacaaacagtgtacgggagcatgcaggcacagcaggaatattggaattgttaaaa
tgtaaagatttacgggcagcattacttggtaagtttaaagaatgctttgggctgtctttt
atagatttaattaggccatttaaaagtgataaaacaacatgtttagattgggtggtagca
gggtttggtatacatcatagcatatcagaggcatttcaaaaattaattgagccattaagt
ttatatgcacatatacaatggctaacaaatgcatggggaatggtattgttagtattatta
agatttaaagtaaataaaagtagaagtaccgttgcacgtacacttgcaacgctattaaat
atacctgaaaaccaaatgttaatagagccaccaaaaatacaaagtggtgttgcagccctg
tattggtttcgtacaggtatatcaaatgccagtacagttataggggaagcaccagaatgg
ataacacgccaaacagttattgaacacgggttggcagacagtcagtttaaattaacagaa
atggtgcagtgggcgtatgataatgacatatgcgaggagagtgaaattgcatttgaatat
gcacaaaggggagattttgattctaatgcacgagcatttttaaatagcaatatgcaggca
aaatatgtgaaagattgtgcaactatgtgtagacattataaacatgcagaaatgaggaag
atgtctataaaacaatggataaaacataggggttctaaaatagaaggcacaggaaattgg
aaaccaattgtacaattcctacgacatcaaaatatagaattcattccttttttaactaaa
tttaaattatggctgcacggtacgccaaaaaaaaactgcatagccatagtaggccctcca
gatactgggaaatcgtacttttgtatgagtttaataagctttctaggaggtacagttatt
agtcatgtaaattccagcagccatttttggttgcaaccgttagtagatgctaaggtagca
ttgttagatgatgcaacacagccatgttggatatatatggatacatatatgagaaatttg
ttagatggtaatcctatgagtattgacagaaagcataaagcattgacattaattaaatgt
ccacctctgctagtaacgtccaacatagatattactaaagaagataaatataagtattta
catactagagtaacaacatttacatttccaaatccattcccttttgacagaaatgggaat
gcagtgtatgaactgtcaaatacaaactggaaatgtttttttgaaagactgtcgtcaagc
ctagacattcaggattctgaggacgaggaagatggaagcaatagccaagcgtttagatgc
gtgccaggaacagttgttagaactttatga

DBGET integrated database retrieval system