KEGG   Viruses: 1489366
Entry
1489366           CDS       T40000                                 
Symbol
E5a, HPV6bgp6
Name
(RefSeq) Human papillomavirus type 6b; E5a protein
Virus
10600  Human papillomavirus type 6b
SSDB
Motif
Pfam: Papilloma_E5A Papilloma_E5
Other DBs
NCBI-GeneID: 1489366
NCBI-ProteinID: NP_040301
RS: NC_001355
UniProt: P06460
LinkDB
Position
NC_001355:3887..4162
AA seq 91 aa
MEVVPVQIAAGTTSTFILPVIIAFVVCFVSIILIVWISEFIVYTSVLVLTLLLYLLLWLL
LTTPLQFFLLTLLVCYCPALYIHYYIVTTQQ
NT seq 276 nt   +upstreamnt  +downstreamnt
atggaagtggtgcctgtacaaatagctgcaggaacaaccagcacattcatactgcctgtt
ataattgcatttgttgtatgttttgttagcatcatacttattgtatggatatctgagttt
attgtgtacacatctgtgctagtactaacactgcttttatatttactattgtggctgcta
ttaacaacccccttgcaatttttcctactaactctacttgtgtgttactgtcccgcattg
tatatacactactatattgttaccacacagcaatga

DBGET integrated database retrieval system