KEGG   Viruses: 1489367
Entry
1489367           CDS       T40000                                 
Symbol
E5b, HPV6bgp7
Name
(RefSeq) Human papillomavirus type 6b; E5b protein
Virus
10600  Human papillomavirus type 6b
SSDB
Motif
Pfam: DUF5472 zf-LITAF-like Ivy
Other DBs
NCBI-GeneID: 1489367
NCBI-ProteinID: NP_040302
RS: NC_001355
UniProt: P06461
LinkDB
Position
NC_001355:4159..4377
AA seq 72 aa
MMLTCQFNDGDTWLGLWLLCAFIVGMLGLLLMHYRAVQGDKHTKCKKCNKHNCNDDYVTM
HYTTDGDYIYMN
NT seq 219 nt   +upstreamnt  +downstreamnt
atgatgctaacatgtcaatttaatgatggagatacctggctgggtttgtggttgttatgt
gcctttattgtagggatgttggggttattattgatgcactatagagctgtacaaggggat
aaacacaccaaatgtaagaagtgtaacaaacacaactgtaatgatgattatgtaactatg
cattatactactgatggtgattatatatatatgaattag

DBGET integrated database retrieval system