KEGG   Viruses: 1489368
Entry
1489368           CDS       T40000                                 
Symbol
E6, HPV6bgp1
Name
(RefSeq) Human papillomavirus type 6b; E6 protein
  KO
K21807  Alphapapillomavirus protein E6
Virus
10600  Human papillomavirus type 6b
SSDB
Motif
Pfam: E6 Spatacsin_C zf-FLZ
Other DBs
NCBI-GeneID: 1489368
NCBI-ProteinID: NP_040296
RS: NC_001355
UniProt: P06462
LinkDB
Position
NC_001355:102..554
AA seq 150 aa
MESANASTSATTIDQLCKTFNLSMHTLQINCVFCKNALTTAEIYSYAYKHLKVLFRGGYP
YAACACCLEFHGKINQYRHFDYAGYATTVEEETKQDILDVLIRCYLCHKPLCEVEKVKHI
LTKARFIKLNCTWKGRCLHCWTTCMEDMLP
NT seq 453 nt   +upstreamnt  +downstreamnt
atggaaagtgcaaatgcctccacgtctgcaacgaccatagaccagttgtgcaagacgttt
aatctatctatgcatacgttgcaaattaattgtgtgttttgcaagaatgcactgaccaca
gcagagatttattcatatgcatataaacacctaaaggtcctgtttcgaggcggctatcca
tatgcagcctgcgcgtgctgcctagaatttcatggaaaaataaaccaatatagacacttt
gattatgctggatatgcaacaacagttgaagaagaaactaaacaagacatcttagacgtg
ctaattcggtgctacctgtgtcacaaaccgctgtgtgaagtagaaaaggtaaaacatata
ctaaccaaggcgcggttcataaagctaaattgtacgtggaagggtcgctgcctacactgc
tggacaacatgcatggaagacatgttaccctaa

DBGET integrated database retrieval system