KEGG   Viruses: 1489369
Entry
1489369           CDS       T40000                                 
Symbol
E7, HPV6bgp2
Name
(RefSeq) Human papillomavirus type 6b; E7 protein
  KO
K21809  HPV protein E7
Taxonomy
TAX:10600 [GN:T40097]
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus; Alphapapillomavirus 10
Organism
vg  Viruses (Alphapapillomavirus 10)
SSDB
Motif
Pfam: E7
Other DBs
NCBI-GeneID: 1489369
NCBI-ProteinID: NP_040297
RS: NC_001355
UniProt: P06464
LinkDB
Position
NC_001355:530..826
AA seq 98 aa
MHGRHVTLKDIVLDLQPPDPVGLHCYEQLVDSSEDEVDEVDGQDSQPLKQHFQIVTCCCG
CDSNVRLVVQCTETDIREVQQLLLGTLNIVCPICAPKT
NT seq 297 nt   +upstreamnt  +downstreamnt
atgcatggaagacatgttaccctaaaggatattgtattagacctgcaacctccagaccct
gtagggttacattgctatgagcaattagtagacagctcagaagatgaggtggacgaagtg
gacggacaagattcacaacctttaaaacaacatttccaaatagtgacctgttgctgtgga
tgtgacagcaacgttcgactggttgtgcagtgtacagaaacagacatcagagaagtgcaa
cagcttctgttgggaacactaaacatagtgtgtcccatctgcgcaccgaagacctaa

DBGET integrated database retrieval system