KEGG   Viruses: 1489370
Entry
1489370           CDS       T40000                                 
Symbol
L1, HPV6bgp9
Name
(RefSeq) Human papillomavirus type 6b; major capsid L1 protein
  KO
K19260  Papillomaviridae major capsid protein L1
Virus
10600  Human papillomavirus type 6b
SSDB
Motif
Pfam: Late_protein_L1
Other DBs
NCBI-GeneID: 1489370
NCBI-ProteinID: NP_040304
RS: NC_001355
UniProt: P69899
LinkDB
Position
NC_001355:5789..7291
AA seq 500 aa
MWRPSDSTVYVPPPNPVSKVVATDAYVTRTNIFYHASSSRLLAVGHPYFSIKRANKTVVP
KVSGYQYRVFKVVLPDPNKFALPDSSLFDPTTQRLVWACTGLEVGRGQPLGVGVSGHPFL
NKYDDVENSGSGGNPGQDNRVNVGMDYKQTQLCMVGCAPPLGEHWGKGKQCTNTPVQAGD
CPPLELITSVIQDGDMVDTGFGAMNFADLQTNKSDVPIDICGTTCKYPDYLQMAADPYGD
RLFFFLRKEQMFARHFFNRAGEVGEPVPDTLIIKGSGNRTSVGSSIYVNTPSGSLVSSEA
QLFNKPYWLQKAQGHNNGICWGNQLFVTVVDTTRSTNMTLCASVTTSSTYTNSDYKEYMR
HVEEYDLQFIFQLCSITLSAEVMAYIHTMNPSVLEDWNFGLSPPPNGTLEDTYRYVQSQA
ITCQKPTPEKEKPDPYKNLSFWEVNLKEKFSSELDQYPLGRKFLLQSGYRGRSSIRTGVK
RPAVSKASAAPKRKRAKTKR
NT seq 1503 nt   +upstreamnt  +downstreamnt
atgtggcggcctagcgacagcacagtatatgtgcctcctcctaaccctgtatccaaagtt
gttgccacggatgcttatgttactcgcaccaacatattttatcatgccagcagttctaga
cttcttgcagtgggacatccttatttttccataaaacgggctaacaaaactgttgtgcca
aaggtgtcaggatatcaatacagggtatttaaggtggtgttaccagatcctaacaaattt
gcattgcctgactcgtctcttttcgatcccacaacacaacgtttagtatgggcatgcaca
ggcctagaggtgggcaggggacagccattaggtgtgggtgtaagtggacatcctttccta
aataaatatgatgatgttgaaaattcagggagtggtggtaaccctggacaggataacagg
gttaatgtaggtatggattataaacaaacacaattatgcatggttggatgtgccccccct
ttgggcgagcattggggtaaaggtaaacagtgtactaatacacctgtacaggctggtgac
tgcccgcccttagaacttattaccagtgttatacaggatggcgatatggttgacacaggc
tttggtgctatgaattttgctgatttgcagaccaataaatcagatgttcctattgacata
tgtggcactacatgtaaatatccagattatttacaaatggctgcagacccatatggtgat
agattatttttttttctacggaaggaacaaatgtttgccagacatttttttaacagggct
ggcgaggtgggggaacctgtgcctgatacacttataattaagggtagtggaaatcgcacg
tctgtagggagtagtatatatgttaacaccccgagcggctctttggtgtcctctgaggca
caattgtttaataagccatattggctacaaaaagcccagggacataacaatggtatttgt
tggggtaatcaactgtttgttactgtggtagataccacacgcagtaccaacatgacatta
tgtgcatccgtaactacatcttccacatacaccaattctgattataaagagtacatgcgt
catgtggaagagtatgatttacaatttatttttcaattatgtagcattacattgtctgct
gaagtaatggcctatattcacacaatgaatccctctgttttggaagactggaactttggg
ttatcgcctcccccaaatggtacattagaagatacctataggtatgtgcagtcacaggcc
attacctgtcaaaagcccactcctgaaaaggaaaagccagatccctataagaaccttagt
ttttgggaggttaatttaaaagaaaagttttctagtgaattggatcagtatcctttggga
cgcaagtttttgttacaaagtggatataggggacggtcctctattcgtacaggtgttaag
cgccctgctgtttccaaagcctctgctgcccctaaacgtaagcgcgccaaaactaaaagg
taa

DBGET integrated database retrieval system