KEGG   Viruses: 1489677
Entry
1489677           CDS       T40000                                 
Symbol
ORF8b, sars8b
Name
(RefSeq) SARS coronavirus Tor2; ORF8b protein
  KO
K24583  SARS coronavirus accessory protein 8
Virus
227984  SARS coronavirus Tor2
SSDB
Motif
Pfam: bCoV_NS8
Other DBs
NCBI-GeneID: 1489677
NCBI-ProteinID: YP_009825060
RS: NC_004718
LinkDB
Position
NC_004718:27864..28118
AA seq 84 aa
MCLKILVRYNTRGNTYSTAWLCALGKVLPFHRWHTMVQTCTPNVTINCQDPAGGALIARC
WYLHEGHQTAAFRDVLVVLNKRTN
NT seq 255 nt   +upstreamnt  +downstreamnt
atgtgcttgaagatccttgtaaggtacaacactaggggtaatacttatagcactgcttgg
ctttgtgctctaggaaaggttttaccttttcatagatggcacactatggttcaaacatgc
acacctaatgttactatcaactgtcaagatccagctggtggtgcgcttatagctaggtgt
tggtaccttcatgaaggtcaccaaactgctgcatttagagacgtacttgttgttttaaat
aaacgaacaaattaa

DBGET integrated database retrieval system