KEGG   Viruses: 1489678
Entry
1489678           CDS       T40000                                 

Symbol
N, sars9a
Name
(RefSeq) SARS coronavirus Tor2; nucleocapsid protein
  KO
K24106  SARS coronavirus nucleocapsid protein
Taxonomy
TAX:227984 [GN:T40069]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB
Motif
Pfam: CoV_nucleocap
Other DBs
NCBI-GeneID: 1489678
NCBI-ProteinID: YP_009825061
RS: NC_004718
LinkDB
Structure
PDB: 
2OFZ 2OG3 2CJR

Position
NC_004718:28120..29388
AA seq 422 aa
MSDNGPQSNQRSAPRITFGGPTDSTDNNQNGGRNGARPKQRRPQGLPNNTASWFTALTQH
GKEELRFPRGQGVPINTNSGPDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEA
SLPYGANKEGIVWVATEGALNTPKDHIGTRNPNNNAATVLQLPQGTTLPKGFYAEGSRGG
SQASSRSSSRSRGNSRNSTPGSSRGNSPARMASGGGETALALLLLDRLNQLESKVSGKGQ
QQQGQTVTKKSAAEASKKPRQKRTATKQYNVTQAFGRRGPEQTQGNFGDQDLIRQGTDYK
HWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYHGAIKLDDKDPQFKDNVILLNKHIDA
YKTFPPTEPKKDKKKKTDEAQPLPQRQKKQPTVTLLPAADMDDFSRQLQNSMSGASADST
QA
NT seq 1269 nt   +upstreamnt  +downstreamnt
atgtctgataatggaccccaatcaaaccaacgtagtgccccccgcattacatttggtgga
cccacagattcaactgacaataaccagaatggaggacgcaatggggcaaggccaaaacag
cgccgaccccaaggtttacccaataatactgcgtcttggttcacagctctcactcagcat
ggcaaggaggaacttagattccctcgaggccagggcgttccaatcaacaccaatagtggt
ccagatgaccaaattggctactaccgaagagctacccgacgagttcgtggtggtgacggc
aaaatgaaagagctcagccccagatggtacttctattacctaggaactggcccagaagct
tcacttccctacggcgctaacaaagaaggcatcgtatgggttgcaactgagggagccttg
aatacacccaaagaccacattggcacccgcaatcctaataacaatgctgccaccgtgcta
caacttcctcaaggaacaacattgccaaaaggcttctacgcagagggaagcagaggcggc
agtcaagcctcttctcgctcctcatcacgtagtcgcggtaattcaagaaattcaactcct
ggcagcagtaggggaaattctcctgctcgaatggctagcggaggtggtgaaactgccctc
gcgctattgctgctagacagattgaaccagcttgagagcaaagtttctggtaaaggccaa
caacaacaaggccaaactgtcactaagaaatctgctgctgaggcatctaaaaagcctcgc
caaaaacgtactgccacaaaacagtacaacgtcactcaagcatttgggagacgtggtcca
gaacaaacccaaggaaatttcggggaccaagacctaatcagacaaggaactgattacaaa
cattggccgcaaattgcacaatttgctccaagtgcctctgcattctttggaatgtcacgc
attggcatggaagtcacaccttcgggaacatggctgacttatcatggagccattaaattg
gatgacaaagatccacaattcaaagacaacgtcatactgctgaacaagcacattgacgca
tacaaaacattcccaccaacagagcctaaaaaggacaaaaagaaaaagactgatgaagct
cagcctttgccgcagagacaaaagaagcagcccactgtgactcttcttcctgcggctgac
atggatgatttctccagacaacttcaaaattccatgagtggagcttctgctgattcaact
caggcataa

DBGET integrated database retrieval system