KEGG   Viruses: 1491938
Entry
1491938           CDS       T40000                                 

Symbol
tax, HTLV1gp7
Name
(RefSeq) Human T-cell leukemia virus type I; p40
  KO
K21857  HTLV protein Tax-1
Taxonomy
TAX:11908 [GN:T40003]
  Lineage
Viruses; ssRNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Deltaretrovirus; Primate T-lymphotropic virus 1
Organism
vg  Viruses (Primate T-lymphotropic virus 1)
SSDB
Motif
Pfam: Tax
Other DBs
NCBI-GeneID: 1491938
NCBI-ProteinID: NP_057864
RS: NC_001436
UniProt: P14079
LinkDB
Position
NC_001436:join(4829..4832,6951..8008)
AA seq 353 aa
MAHFPGFGQSLLFGYPVYVFGDCVQGDWCPISGGLCSARLHRHALLATCPEHQITWDPID
GRVIGSALQFLIPRLPSFPTQRTSKTLKVLTPPITHTTPNIPPSFLQAMRKYSPFRNGYM
EPTLGQHLPTLSFPDPGLRPQNLYTLWGGSVVCMYLYQLSPPITWPLLPHVIFCHPGQLG
AFLTNVPYKRIEKLLYKISLTTGALIILPEDCLPTTLFQPARAPVTLTAWQNGLLPFHST
LTTPGLIWTFTDGTPMISGPCPKDGQPSLVLQSSSFIFHKFQTKAYHPSFLLSHGLIQYS
SFHNLHLLFEEYTNIPISLLFNEKEADDNDHEPQISPGGLEPLSEKHFRETEV
NT seq 1062 nt   +upstreamnt  +downstreamnt
atggcccacttcccagggtttggacagagtcttcttttcggatacccagtctacgtgttt
ggagactgtgtacaaggcgactggtgccccatctctgggggactatgttcggcccgccta
catcgtcacgccctactggccacctgtccagagcatcagatcacctgggaccccatcgat
ggacgcgttatcggctcagctctacagttccttatccctcgactcccctccttccccacc
cagagaacctctaagacccttaaggtccttaccccgccaatcactcatacaacccccaac
attccaccctccttcctccaggccatgcgcaaatactcccccttccgaaatggatacatg
gaacccacccttgggcagcacctcccaaccctgtcttttccagaccccggactccggccc
caaaacctgtacaccctctggggaggctccgttgtctgcatgtacctctaccagctttcc
ccccccatcacctggcccctcctgccccatgtgattttttgccaccccggccagctcggg
gccttcctcaccaatgttccctacaaacgaatagaaaaactcctctataaaatttccctt
accacaggggccctaataattctacccgaggactgtttgcccaccacccttttccagcct
gctagggcacccgtcacgctgacagcctggcaaaacggcctccttccgttccactcaacc
ctcaccactccaggccttatttggacatttaccgatggcacgcctatgatttccgggccc
tgccctaaagatggccagccatctttagtactacagtcctcctcctttatatttcacaaa
tttcaaaccaaggcctaccacccctcatttctactctcacacggcctcatacagtactct
tcctttcataatttgcatctcctatttgaagaatacaccaacatccccatttctctactt
tttaacgaaaaagaggcagatgacaatgaccatgagccccaaatatcccccgggggctta
gagcctctcagtgaaaaacatttccgtgaaacagaagtctga

DBGET integrated database retrieval system