KEGG   Viruses: 1724717
Entry
1724717           CDS       T40000                                 

Gene name
HIV2gp7
Definition
(RefSeq) Human immunodeficiency virus 2; env polyprotein
  KO
K19287  HIV envelope glycoprotein gp160
Taxonomy
TAX:11709 [GN:T40002]
  Lineage
Viruses; ssRNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus
Organism
vg  Viruses (Human immunodeficiency virus 2)
SSDB
Motif
Pfam: GP120 GP41
Other DBs
NCBI-GeneID: 1724717
NCBI-ProteinID: NP_056844
RS: NC_001722
UniProt: P18094 A0A7D6GYH3
LinkDB
Position
NC_001722:6704..9286
AA seq 860 aa
MEPGRNQLFVVILLTSACLVYCSQYVTVFYGIPAWKNASIPLFCATKNRDTWGTIQCLPD
NDDYQEIILNVTEAFDAWNNTVTEQAVEDVWHLFETSIKPCVKLTPLCVAMNCSRVQGNT
TTPNPRTSSSTTSRPPTSAASIINETSNCIENNTCAGLGYEEMMQCEFNMKGLEQDKKRR
YKDTWYLEDVVCDNTTAGTCYMRHCNTSIIKESCDKHYWDAMRFRYCAPPGFALLRCNDT
NYSGFEPKCTKVVAASCTRMMETQTSTWFGFNGTRAENRTYIYWHGRDNRTIISLNKYYN
LTMRCKRPGNKTVLPITLMSGLVFHSQPINTRPRQAWCRFGGRWREAMQEVKQTLVQHPR
YKGINDTGKINFTKPGAGSDPEVAFMWTNCRGEFLYCNMTWFLNWVEDKNQTRRNYCHIK
QIINTWHKVGKNVYLPPREGELACESTVTSIIANIDIDKNRTHTNITFSAEVAELYRLEL
GDYKLIEITPIGFAPTDQRRYSSTPVRNKRGVFVLGFLGFLATAGSAMGARSLTLSAQSR
TLLAGIVQQQQQLLDVVKRQQEMLRLTVWGTKNLQARVTAIEKYLKHQAQLNSWGCAFRQ
VCHTTVPWVNDSLSPDWKNMTWQEWEKQVRYLEANISQSLEEAQIQQEKNMYELQKLNSW
DILGNWFDLTSWVKYIQYGVHIVVGIIALRIAIYVVQLLSRFRKGYRPVFSSPPGYLQQI
HIHKDRGQPANEGTEEDVGGDSGYDLWPWPINYVQFLIHLLTRLLIGLYNICRDLLSKNS
PTRRLISQSLTAIRDWLRLKAAQLQYGCEWIQEAFQAFARTTRETLAGAWGWLWEAARRI
GRGILAVPRRIRQGAELALL
NT seq 2583 nt   +upstreamnt  +downstreamnt
atggagcctggtaggaatcagctgtttgttgtcattttactaacaagtgcttgcttagta
tattgtagccagtatgtgactgttttctatggcatacccgcgtggaaaaatgcatctatt
cccttattttgtgcaactaaaaatagagacacttgggggaccatacagtgcttgccagac
aatgatgattatcaggaaataattttaaatgtgacagaggcttttgatgcatggaataat
acagtgacagaacaagcagtagaagatgtctggcatctatttgagacatcaataaaacca
tgtgtcaagctaacacctctatgtgtggcaatgaattgtagcagggttcaagggaatacc
acgaccccgaatcccaggacctcgagttccacaacctcgagaccacccacatccgcagcc
tccataataaatgaaacttctaactgcatagaaaacaacacatgcgcaggattagggtat
gaggagatgatgcaatgtgagttcaatatgaaggggttagaacaagataagaaaaggagg
tataaggacacatggtatttagaagatgtggtttgtgacaacacaacagctggcacatgt
tacatgagacattgcaacacatcaatcatcaaagagtcatgtgataagcactattgggat
gctatgaggtttagatactgtgcaccaccgggctttgccctattaagatgtaatgatacc
aactattcaggctttgaacctaagtgcactaaagtagtagctgcttcatgcacaaggatg
atggaaacgcaaacttctacttggtttggctttaatggcactagagcagaaaatagaaca
tatatctattggcatggcagagataataggactatcattagcttaaacaagtattataat
ctcacaatgcgttgtaagagaccaggaaataagacagttttaccaataacacttatgtca
ggattagtgtttcactctcagccaatcaacacaaggcctaggcaggcatggtgccggttt
ggaggcagatggagggaagccatgcaggaggtgaagcaaacccttgtacaacatcccaga
tacaaaggaatcaatgatacagggaaaattaactttacgaaaccgggagcaggctcagac
ccggaagtggcatttatgtggactaactgcagaggagaatttctctactgtaacatgact
tggttcctcaattgggtagaagacaagaaccaaacacggcgcaactattgccatataaag
cagataattaatacctggcataaagtagggaaaaatgtatatttgcctcctagggaaggg
gagttggcctgtgaatcaacagtaaccagcataattgctaacattgacatagataaaaat
cggactcataccaacattacctttagtgcagaagtggcagaactgtaccgattagaactg
ggagactacaaattaatagaaataacaccaattggcttcgcacctacagatcagagaagg
tactcctcaactccagtgaggaacaaaagaggtgtgttcgtgctagggttcttgggtttt
ctcgcgacagcaggttctgcaatgggcgcgcggtccctgacgctgtcagcccagtcccgg
actttactggccgggatagtgcagcaacagcaacagctgttggacgtagtcaagagacaa
caagaaatgttgcgactgaccgtctggggaacgaaaaacctccaggcaagagtcactgct
atcgagaagtacctaaagcatcaggcacagctaaattcatggggatgtgcgtttagacag
gtctgccacactactgtaccgtgggtaaatgactctttatcgcctgactggaaaaatatg
acatggcaggagtgggagaaacaagtccgctacctagaggcaaatatcagtcaaagttta
gaagaagcccaaattcaacaagaaaagaatatgtatgaattacaaaaattaaatagctgg
gatattcttggcaactggtttgacttaacctcctgggtcaagtatattcaatatggagtg
catatagtagtgggaataatagctttaagaatagcaatctatgtagtgcaattgttaagt
agatttagaaagggctataggcctgttttctcttccccccccggttatctccaacagatc
catatccacaaggaccggggacagccagccaacgaaggaacagaagaagacgtcggaggc
gacagtggttacgacttgtggccttggccaataaactatgtgcagttcctgatccaccta
ctgactcgcctcttgatcgggctatacaacatctgcagagacttactatccaagaactcc
ccgacccgccgactgatctcccagagtctaacagcaatcagggactggctgagacttaag
gcggcccaactgcaatatgggtgcgagtggatccaagaagctttccaagcattcgcgagg
actacgagagagactcttgcgggcgcgtggggatggttatgggaagcagcgcgacgcatc
gggaggggaatactcgcagttccaagaagaatcaggcagggagcagaactcgccctcctg
tga

DBGET integrated database retrieval system