KEGG   Viruses: 1724972
Entry
1724972           CDS       T40000                                 

Symbol
STLV2gp07
Name
(RefSeq) Simian T-lymphotropic virus 2; tax protein
  KO
K21857  HTLV protein Tax-1
Taxonomy
TAX:33748
  Lineage
Viruses; ssRNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Deltaretrovirus; Primate T-lymphotropic virus 2
Organism
vg  Viruses (Primate T-lymphotropic virus 2)
SSDB
Motif
Pfam: Tax
Other DBs
NCBI-GeneID: 1724972
NCBI-ProteinID: NP_056910
RS: NC_001815
UniProt: O70643
LinkDB
Position
NC_001815:join(5153..5155,7167..8207)
AA seq 347 aa
MAHFPGFGQSLLYGYPVYVFGDCVQADWCPVSGGLCSTRLHRHALLATCPEHQLTWDPID
GRVVGSPLQYLIPRLPSFPTQRTSKTLKVLTPPTTPVSPKIPPAFFQSMRKLSPYRNGCL
YPTLGDQLPSLAFPDPGLRPQNIYTTWGRTVVCLYLYQLSPPMTWPLIPHVIFCHPKQLG
TFLTNVPLKRLEELLYKIFLHTGAIIVLPEDTLPTTLFQPVRAPCVQTAWDTGLLPYHSL
ITTPGLIWTFNDGSPMISGPCPKPGQPSLVVQSSLLIFEKFQTKAFHPSYLLSHQLIQYS
SFHNLHLLFEEYTNIPXSYLFNEKEADDSDSDPGPSNLGAAQGESSA
NT seq 1044 nt   +upstreamnt  +downstreamnt
atggcccactttccaggtttcggacagagcctcctctatggatacccagtctacgtgttt
ggcgattgtgttcaagccgattggtgtcccgtttcaggtgggctttgttccacccgcctg
caccggcatgcccttctcgccacctgcccggagcaccagctcacctgggaccccatcgat
ggacgcgttgtcggctctcctctccaataccttatccctcggctcccctccttccccacc
cagagaacctccaagaccctcaaggtcctcactccccctaccactcctgtctcccccaag
attccacccgcctttttccaatccatgcgtaaactctccccctaccggaacgggtgccta
tacccaactctcggagaccagctcccctcccttgccttccccgaccccggtctccggccc
caaaacatctacaccacctggggaagaaccgtagtttgcttgtacctctaccaactatct
cccccgatgacctggcccttaatacctcacgtcatattttgccatcccaagcagttaggg
accttcctgaccaacgtacctctaaaacgcttggaagaattactatacaaaatattcttg
cataccggggccattatagtactccccgaagacaccctccctactacattgttccaacct
gttagagccccctgcgtccagacggcttgggacacggggcttttaccctaccactctctc
ataactactccaggcctaatatggacgttcaatgacggttcgcccatgatttccggcccc
tgccccaaaccggggcagccatctttggtggtacaatcctccctgttaatctttgaaaaa
ttccagaccaaagcttttcatccttcctacctactgtcccatcaactcatccagtactcc
tcgttccataacctccaccttctcttcgaggagtatactaacattccagnttcctatttg
tttaacgaaaaagaggcagatgacagtgactctgaccctgggccttctaacctcggggcc
gcccagggcgagtcatcagcttaa

DBGET integrated database retrieval system