KEGG   Viruses: 2949774
Entry
2949774           CDS       T40000                                 
Symbol
CeHV15gBNLF2a
Name
(RefSeq) Macacine gammaherpesvirus 4; BNLF2a
  KO
K22974  EBV protein BNLF2a
Taxonomy
TAX:45455
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus
Organism
vg  Viruses (Macacine gammaherpesvirus 4)
SSDB
Other DBs
NCBI-GeneID: 2949774
NCBI-ProteinID: YP_068016
RS: NC_006146
UniProt: Q8UZC8
LinkDB
Position
NC_006146:complement(163265..163444)
AA seq 59 aa
MVFFLNPGFLEQRYPAYGLPGSSEGQKPSHCPVKEELKNLRICLVVLCALFGLVCLLLI
NT seq 180 nt   +upstreamnt  +downstreamnt
atggtcttctttctgaacccggggttcctggagcagcgctaccctgcctacggcctgccc
ggctcctctgaggggcagaagccaagccactgcccggtcaaagaagagctcaagaacctg
agaatctgcctggtcgtgctctgcgccctgtttggtctcgtctgcctgctactaatctaa

DBGET integrated database retrieval system