KEGG   Viruses: 3077506
Entry
3077506           CDS       T40000                                 

Symbol
UL111A, HHV5wtgp098
Name
(RefSeq) Human betaherpesvirus 5; interleukin-10
  KO
K21533  EBV viral interleukin 10
Taxonomy
TAX:10359 [GN:T40080]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus
Organism
vg  Viruses (Human betaherpesvirus 5)
SSDB
Motif
Pfam: IL10
Other DBs
NCBI-GeneID: 3077506
NCBI-ProteinID: YP_081552
RS: NC_006273
UniProt: F5HC71 Q9J4B7 B9VXR2
LinkDB
Structure
PDB: 
1LQS

Position
NC_006273:join(161003..161185,161262..161462,161546..161692)
AA seq 176 aa
MLSVMVSSSLVLIVFFLGASEEAKPATTTTIKNTKPQCRPEDYATRLQDLRVTFHRVKPT
LQREDDYSVWLDGTVVKGCWGCSVMDWLLRRYLEIVFPAGDHVYPGLKTELHSMRSTLES
IYKDMRQCPLLGCGDKSVISRLSQEAERKSDNGTRKGLSELDTLFSRLEEYLHSRK
NT seq 531 nt   +upstreamnt  +downstreamnt
atgctgtcggtgatggtctcttcctctctggtcctgatcgtcttttttctaggcgcttcc
gaggaggcgaagccggcaacgacgacgacgataaagaatacaaagccgcagtgtcgtcca
gaggattacgcgaccagattgcaagatctccgcgtcacctttcatcgagtaaaacctacg
ttgcaacgtgaggacgactactccgtgtggctcgacggtacggtggtcaaaggctgttgg
ggatgcagcgtcatggactggttgttgaggcggtatctggagatcgtgttccccgcaggc
gaccacgtctatcctggacttaagacggaattgcatagtatgcgctcgacgctagaatcc
atctacaaagacatgcggcaatgccctctgttaggttgcggagataagtccgtgattagt
cggctgtctcaggaggcggaaaggaaatcggataacggcacgcggaaaggtctcagcgag
ttggacacgttgtttagccgtctcgaagagtatctgcactcgagaaagtag

DBGET integrated database retrieval system