KEGG   Viruses: 30855111
Entry
30855111          CDS       T40000                                 

Symbol
BWV06_gp099
Name
(RefSeq) Cynomolgus cytomegalovirus; Cy143
  KO
K21533  EBV viral interleukin 10
Taxonomy
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Betaherpesvirinae; Cytomegalovirus; unclassified Cytomegalovirus
Organism
vg  Viruses (Cynomolgus cytomegalovirus)
SSDB
Motif
Pfam: IL10
Other DBs
NCBI-GeneID: 30855111
NCBI-ProteinID: YP_009337544
RS: NC_033176
UniProt: A0A1L6Z1J1
LinkDB
Position
NC_033176:join(145152..145340,145435..145656,146094..146156,146241..146327)
AA seq 186 aa
MRRRRSFGIVVAGAIGTLLMMAVVVFSAHEHKEVPPACDPVHGNLAGIFKELRATYASIR
EGLQKKDTVYYTSLFNDRVLQEMLSPMGCRVTNELMEHYLDGVLPRALHLDYDNSTLNGL
HAFASSMQALYQHMLKCPALACTGKTPAWMYFLEVEHKLNPWRGTAKAAAEADLLLNYLE
TFLLQF
NT seq 561 nt   +upstreamnt  +downstreamnt
atgcggaggagaaggtctttcggcatcgtcgtcgccggcgctatcggaacactactcatg
atggcggtggtcgtgttctcagcccatgaacacaaagaagtaccaccggcctgtgatccc
gttcacggtaacttggcaggcatcttcaaggagttgcgggcgacatacgcttccattaga
gaaggcttgcaaaagaaggacacggtgtactacacatcgctgttcaatgaccgcgtgctc
caggaaatgctgagtcctatgggctgtcgcgtgaccaacgaactcatggaacattattta
gatggtgttctgcctcgagcgttgcatttggactacgataatagcactctgaatggctta
catgcgtttgcttcatccatgcaggcgctgtatcagcacatgttaaagtgtcccgcgttg
gcatgtactggcaaaacgccagcttggatgtacttcttggaggtggaacacaagctcaac
ccctggaggggcacggccaaagccgcggccgaggctgaccttttgctgaactacttggaa
acgttcctgctgcagttctga

DBGET integrated database retrieval system