KEGG   Viruses: 3783706
Entry
3783706           CDS       T40000                                 
Symbol
BHRF1, HHV4_BHRF1
Name
(RefSeq) Human gammaherpesvirus 4; apoptosis regulator BHRF1
  KO
K19463  Lymphocryptovirus apoptosis regulator BHRF1
Taxonomy
TAX:10376 [GN:T40079]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae/Gammaherpesvirinae; Lymphocryptovirus
Organism
10376  Viruses (Human gammaherpesvirus 4)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 3783706
NCBI-ProteinID: YP_401646
RS: NC_007605
UniProt: P0C6Z1 P03182 K9UTN7
Structure
LinkDB
Position
NC_007605:42088..42663
AA seq 191 aa
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIER
NSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQS
TPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVI
CSYLFISRGRH
NT seq 576 nt   +upstreamnt  +downstreamnt
atggcctattcaacaagggagatactgttagccctgtgtatacgggacagtcgtgtgcat
ggaaatggtaccctgcatcctgtgttggagctagcagcaagagaaacacctctccgcctt
tcgccagaggacactgtagttctgcgttatcatgtgttgcttgaggagataattgaacga
aattcagagacatttacagaaacttggaacagatttataacacacaccgaacatgtggat
ctggattttaactcagtatttttagagatatttcaccgtggagacccaagccttgggcgc
gcgttggcctggatggcctggtgcatgcatgcctgcaggacattgtgttgtaaccagtct
actccttactatgttgtggacctgtcagttcgtgggatgttagaagccagcgaaggcctg
gatggttggattcatcaacagggcggctggtctacattaattgaagacaacattcctgga
tccagaaggtttagctggactttgtttcttgctggactgactttgagtctgttagttata
tgtagttatttatttatctccagaggaagacactaa

DBGET integrated database retrieval system