KEGG   Viruses: 3783720
Entry
3783720           CDS       T40000                                 
Symbol
BNLF2a, HHV4_BNLF2a
Name
(RefSeq) Human gammaherpesvirus 4; protein BNLF2a
  KO
K22974  EBV protein BNLF2a
Taxonomy
TAX:10376 [GN:T40079]
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus
Organism
vg  Viruses (Human gammaherpesvirus 4)
SSDB
Other DBs
NCBI-GeneID: 3783720
NCBI-ProteinID: YP_401721
RS: NC_007605
UniProt: P0C737 P0C739 P0C738 G3CKT0
LinkDB
Position
NC_007605:complement(166846..167028)
AA seq 60 aa
MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI
NT seq 183 nt   +upstreamnt  +downstreamnt
atggtacacgtcctggagcgtgctttgctagagcagcagtcctctgcctgcggcctgccc
ggctcttctacggagaccaggcctagccacccctgccccgaggacccagacgtcagcaga
ctaagactactcctggtggtactctgtgtcctgtttggacttttatgcctgctcctcatc
taa

DBGET integrated database retrieval system