KEGG   Viruses: 43740570
Entry
43740570          CDS       T40000                                 

Gene name
E, GU280_gp04
Definition
(RefSeq) Severe acute respiratory syndrome coronavirus 2; envelope protein
  KO
K24151  SARS coronavirus envelope small membrane protein
Taxonomy
TAX:2697049 [GN:T40361]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB
Motif
Pfam: CoV_E EVC2_like FAM163
Other DBs
NCBI-GeneID: 43740570
NCBI-ProteinID: YP_009724392
RS: NC_045512
UniProt: P0DTC4
LinkDB
Position
NC_045512:26245..26472
AA seq 75 aa
MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYS
RVKNLNSSRVPDLLV
NT seq 228 nt   +upstreamnt  +downstreamnt
atgtactcattcgtttcggaagagacaggtacgttaatagttaatagcgtacttcttttt
cttgctttcgtggtattcttgctagttacactagccatccttactgcgcttcgattgtgt
gcgtactgctgcaatattgttaacgtgagtcttgtaaaaccttctttttacgtttactct
cgtgttaaaaatctgaattcttctagagttcctgatcttctggtctaa

DBGET integrated database retrieval system