KEGG   Viruses: 43740571
Entry
43740571          CDS       T40000                                 

Gene name
M, GU280_gp05
Definition
(RefSeq) Severe acute respiratory syndrome coronavirus 2; membrane glycoprotein
  KO
K24150  SARS coronavirus membrane protein
Taxonomy
TAX:2697049 [GN:T40361]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB
Motif
Pfam: CoV_M EF-hand_6 EF-hand_1
Other DBs
NCBI-GeneID: 43740571
NCBI-ProteinID: YP_009724393
RS: NC_045512
UniProt: P0DTC5
LinkDB
Position
NC_045512:26523..27191
AA seq 222 aa
MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNRFLYIIKLIFLWLLWPV
TLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRLFARTRSMWSFNPETNILL
NVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCDIKDLPKEITVATSRTLSYYK
LGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIALLVQ
NT seq 669 nt   +upstreamnt  +downstreamnt
atggcagattccaacggtactattaccgttgaagagcttaaaaagctccttgaacaatgg
aacctagtaataggtttcctattccttacatggatttgtcttctacaatttgcctatgcc
aacaggaataggtttttgtatataattaagttaattttcctctggctgttatggccagta
actttagcttgttttgtgcttgctgctgtttacagaataaattggatcaccggtggaatt
gctatcgcaatggcttgtcttgtaggcttgatgtggctcagctacttcattgcttctttc
agactgtttgcgcgtacgcgttccatgtggtcattcaatccagaaactaacattcttctc
aacgtgccactccatggcactattctgaccagaccgcttctagaaagtgaactcgtaatc
ggagctgtgatccttcgtggacatcttcgtattgctggacaccatctaggacgctgtgac
atcaaggacctgcctaaagaaatcactgttgctacatcacgaacgctttcttattacaaa
ttgggagcttcgcagcgtgtagcaggtgactcaggttttgctgcatacagtcgctacagg
attggcaactataaattaaacacagaccattccagtagcagtgacaatattgctttgctt
gtacagtaa

DBGET integrated database retrieval system