KEGG   Viruses: 43740577
Entry
43740577          CDS       T40000                                 

Gene name
ORF8, GU280_gp09
Definition
(RefSeq) Severe acute respiratory syndrome coronavirus 2; ORF8 protein
  KO
K24583  SARS coronavirus accessory protein 8
Taxonomy
TAX:2697049 [GN:T40361]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; Severe acute respiratory syndrome-related coronavirus
Organism
vg  Viruses (Severe acute respiratory syndrome-related coronavirus)
SSDB
Motif
Pfam: bCoV_NS8
Other DBs
NCBI-GeneID: 43740577
NCBI-ProteinID: YP_009724396
RS: NC_045512
UniProt: P0DTC8
LinkDB
Position
NC_045512:27894..28259
AA seq 121 aa
MKFLVFLGIITTVAAFHQECSLQSCTQHQPYVVDDPCPIHFYSKWYIRVGARKSAPLIEL
CVDEAGSKSPIQYIDIGNYTVSCLPFTINCQEPKLGSLVVRCSFYEDFLEYHDVRVVLDF
I
NT seq 366 nt   +upstreamnt  +downstreamnt
atgaaatttcttgttttcttaggaatcatcacaactgtagctgcatttcaccaagaatgt
agtttacagtcatgtactcaacatcaaccatatgtagttgatgacccgtgtcctattcac
ttctattctaaatggtatattagagtaggagctagaaaatcagcacctttaattgaattg
tgcgtggatgaggctggttctaaatcacccattcagtacatcgatatcggtaattataca
gtttcctgtttaccttttacaattaattgccaggaacctaaattgggtagtcttgtagtg
cgttgttcgttctatgaagactttttagagtatcatgacgttcgtgttgttttagatttc
atctaa

DBGET integrated database retrieval system