KEGG   Viruses: 4783424
Entry
4783424           CDS       T40000                                 

Symbol
UL44, BoHV1_gp105
Name
(RefSeq) Bovine alphaherpesvirus 1; envelope glycoprotein C
  KO
K19256  Simplexvirus envelope glycoprotein C
Taxonomy
TAX:10320
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Varicellovirus
Organism
vg  Viruses (Bovine alphaherpesvirus 1)
SSDB
Motif
Pfam: Marek_A Ig_3 C1-set
Other DBs
NCBI-GeneID: 4783424
NCBI-ProteinID: NP_045314
RS: NC_001847
UniProt: Q77CE0 Q65821
LinkDB
Position
NC_001847:complement(16683..18209)
AA seq 508 aa
MGPLGRAWLIAAIFAWALLSARRGLAEEAEASPSPPPSPSPTETESSAGTTGATPPTPNS
PDATPEDSTPGATTPVGTPEPPSVSEHDPPVTNSTPPPAPPEDGRPGGAGNASRDGRPSG
GGRPRPPRPSKAPPKERKWMLCEREAVAASYAEPLYVHCGVADNATGGARLELWFQRVGR
FRSTRGDDEAVRNPFPRAPPVLLFVAQNGSIAYRSAELGDNYIFPSPADPRNLPLTVRSL
TAATEGVYTWRRDMGTKSQRKVVTVTTHRAPAVSVEPQPALEGAGYAAVCRAAEYYPPRS
TRLHWFRNGYPVEARHARDVFTVDDSGLFSRTSVLTLEDATPTAHPPNLRCDVSWFQSAN
MERRFYAAGTPAVYRPPELRVYFEGGEAVCEARCVPEGRVSLRWTVRDGIAPSRTEQTGV
CAERPGLVNLRGVRLLSTTDGPVDYTCTATGYPAPLPEFSATATYDASPGLIGSPVLVSV
VAVACGLGAVGLLLVAASCLRRKARARL
NT seq 1527 nt   +upstreamnt  +downstreamnt
atgggcccgctggggcgagcgtggctgatcgcagctattttcgcctgggcgctcctgtct
gcccggcgggggctcgccgaggaggcggaagcctcgccctcgcctccgccctccccgtcc
ccaaccgagacggaaagctccgctgggaccaccggcgcaacgccccccacgcccaacagc
cccgacgctacgccagaggacagcacgcccggtgctactacgcccgtggggacgccggag
ccgccgtccgtgtccgagcacgacccgcccgttaccaacagcacgccgccgcccgccccg
cccgaggacgggcgacccggcggcgctggcaacgcgagccgcgatgggcgacctagcggc
ggggggcggcctcgccccccgcggccgagcaaagccccgccgaaggagcgcaagtggatg
ctctgcgagcgcgaggccgtggccgcctcgtacgccgagccgctgtacgtgcactgcggc
gtggccgacaacgccactggcggtgcgcgcctggagctctggtttcagcgcgtgggcagg
ttccgctccacgcgcggcgacgacgaggccgtgcgcaacccctttccgcgggccccgccc
gtgctgctgttcgtagcccagaacggctcgatcgcgtaccgtagcgcggagctgggcgac
aactatattttcccttcgcccgccgacccccgcaacttgcccctgaccgtgcgctccctg
acggccgccaccgagggcgtgtacacttggcgccgcgacatgggcaccaagtcacagcgc
aaggtcgtgaccgtcacgacgcaccgcgcgcccgctgtttccgtcgaaccccagccagcg
ctagaaggcgccggctacgcggccgtgtgccgcgccgccgagtactacccgccgcgctcc
acgcgcctgcactggttccgcaacggctaccccgtggaggctcggcacgcgcgcgacgtc
tttacggtcgacgactccgggctcttttcgcgcacgtccgtccttacgctcgaggacgcg
acgccaaccgcccacccgcccaacctgcgctgcgacgtctcctggttccagagcgctaac
atggagcgccgcttttacgcggctggcacgccggccgtttaccgcccgcccgagctgcgc
gtgtacttcgagggcggcgaggccgtctgcgaggcgcgctgcgtccccgaggggcgcgtc
tccctgcgctggacggtgcgcgacggcatcgccccgtcgcgcactgagcagaccggcgtc
tgcgccgagcggcccgggctggtaaacctgcgcggcgtgcgcctgctttctacaaccgac
gggcccgtcgactacacctgcaccgccactggctacccggcaccgctgcccgagttctcc
gcgaccgccacgtacgacgcctcgcccggcctaatcggaagccccgtcctcgtcagcgtc
gtggccgtcgcctgcggtctcggcgccgtggggctcctgctggtggcggcctcgtgcctg
cggcgcaaggcccgggcgcgcctgtag

DBGET integrated database retrieval system