KEGG   Viruses: 4961449
Entry
4961449           CDS       T40000                                 
Symbol
K2, HHV8GK18_gp10
Name
(RefSeq) Human gammaherpesvirus 8; K2
  KO
K21670  KSHV interleukin 6
Virus
37296  Human gammaherpesvirus 8
SSDB
Motif
Pfam: IL6
Other DBs
NCBI-GeneID: 4961449
NCBI-ProteinID: YP_001129358
RS: NC_009333
UniProt: Q2HRC7
LinkDB
Position
NC_009333:complement(17227..17841)
AA seq 204 aa
MRWFKLWSILLVGSLLVSGTRGKLPDAPEFEKDLLIQRLNWMLWVIDECFRDLCYRTGIC
KGILEPAAIFHLKLPAINDTDHCGLIGFNETSCLKKLADGFFEFEVLFKFLTTEFGKSVI
NVDVMELLTKTLGWDIQEELNKLTKTHYSPPKFDRGLLGRLQGLKYWVRHFASFYVLSAM
EKFAGQAVRVLNSIPDVTPDVHDK
NT seq 615 nt   +upstreamnt  +downstreamnt
atgcgctggttcaagttgtggtctatcttgctggtcggttcactgctggtatctggaacg
cggggcaagttgccggacgcccccgagtttgaaaaggatcttctcattcagagactcaat
tggatgctatgggtgatcgatgaatgcttccgcgacctctgttaccgtaccggcatctgc
aagggtattctagagcccgctgctatttttcatctgaaactaccagccatcaacgatact
gatcactgcgggttaataggatttaatgagactagctgccttaaaaagctcgccgatggc
tttttcgaattcgaggtgttgtttaagtttttaacgacggagtttggaaaatcagtgata
aacgtggacgtcatggagcttctgacgaagaccttaggatgggacatacaggaagagctc
aataagctgactaagacgcactacagtccacccaaatttgaccgcggtctattagggagg
cttcagggacttaagtattgggtgagacactttgcttcgttttatgttctgagtgcaatg
gaaaagtttgcaggtcaagcggtgcgtgttttgaactctatcccagacgtgactcctgac
gtccacgataagtaa

DBGET integrated database retrieval system