KEGG   Viruses: 5176159
Entry
5176159           CDS       T40000                                 
Symbol
HHV4tp2_gp79
Name
(RefSeq) Human herpesvirus 4 type 2; BNLF2a
  KO
K22974  EBV protein BNLF2a
Taxonomy
TAX:12509
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Gammaherpesvirinae; Lymphocryptovirus; unclassified Roseolovirus
Organism
vg  Viruses (Human gammaherpesvirus 4)
SSDB
Other DBs
NCBI-GeneID: 5176159
NCBI-ProteinID: YP_001129514
RS: NC_009334
UniProt: P0C737
LinkDB
Position
NC_009334:complement(168330..168512)
AA seq 60 aa
MVHVLERALLEQQSSACGLPGSSTETRPSHPCPEDPDVSRLRLLLVVLCVLFGLLCLLLI
NT seq 183 nt   +upstreamnt  +downstreamnt
atggtacacgtcctggagcgtgctttgctagagcagcagtcctctgcctgcggcctgccc
ggctcttctacggagaccaggcctagccacccctgccccgaggacccagacgtcagcaga
ctaagactactcctggtggtactctgtgtcctgtttggacttttatgcctgctcctcatc
taa

DBGET integrated database retrieval system