KEGG   Viruses: 5176205
Entry
5176205           CDS       T40000                                 
Symbol
HHV4tp2_gp07
Name
(RefSeq) Human herpesvirus 4 type 2; BHRF1
  KO
K19463  Lymphocryptovirus apoptosis regulator BHRF1
Taxonomy
TAX:12509
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae/Gammaherpesvirinae; Lymphocryptovirus; Macacine betaherpesvirus 9
Organism
12509  Viruses (Human gammaherpesvirus 4)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 5176205
NCBI-ProteinID: YP_001129442
RS: NC_009334
UniProt: P0C6Z1
Structure
LinkDB
Position
NC_009334:42204..42779
AA seq 191 aa
MAYSTREILLALCIRDSRVHGNGTLHPVLELAARETPLRLSPEDTVVLRYHVLLEEIIER
NSETFTETWNRFITHTEHVDLDFNSVFLEIFHRGDPSLGRALAWMAWCMHACRTLCCNQS
TPYYVVDLSVRGMLEASEGLDGWIHQQGGWSTLIEDNIPGSRRFSWTLFLAGLTLSLLVI
CSYLFISRGRH
NT seq 576 nt   +upstreamnt  +downstreamnt
atggcctattcaacaagggagatactgttagccctgtgtatacgggacagtcgtgtgcat
ggaaatggtaccctgcatcctgtgttggagctagcagcaagagaaacacctctccgcctt
tcgccagaggacactgtagttctgcgttatcatgtgttgcttgaggagataattgaacga
aattcagagacatttacagaaacttggaacagatttataacacacaccgaacatgtggac
ctggattttaactcagtatttttagagatatttcaccgtggagacccaagccttgggcgc
gcgttggcctggatggcctggtgcatgcatgcctgcaggacattgtgttgtaaccagtct
actccttactatgttgtggacctgtcagttcgtgggatgttagaagccagcgaaggcctg
gatggttggattcatcaacagggcggctggtctacattaattgaagacaacattcctgga
tccagaaggtttagctggactttgtttcttgctggactgactttgagtctgttagttata
tgtagttatttatttatctccagaggaagacactaa

DBGET integrated database retrieval system