KEGG   Viruses: 951485
Entry
951485            CDS       T40000                                 
Symbol
E7, HpV90gp2
Name
(RefSeq) Human papillomavirus type 90; putative transforming protein E7
  KO
K21809  HPV protein E7
Taxonomy
TAX:333769
  Lineage
Viruses; dsDNA viruses; Monodnaviria; Shotokuvirae; Cossaviricota; Papovaviricetes; Zurhausenvirales; Papillomaviridae; Firstpapillomavirinae; Alphapapillomavirus; Alphapapillomavirus 14
Organism
vg  Viruses (Alphapapillomavirus 14)
SSDB
Motif
Pfam: E7 DUF4186
Other DBs
NCBI-GeneID: 951485
NCBI-ProteinID: NP_671504
RS: NC_004104
UniProt: Q8JNA0
LinkDB
Position
NC_004104:423..719
AA seq 98 aa
MHGQRPTLKDIFLELDQPDAVDLHCNEQLASSEEEDNREDGEQPTQPTEPAQQAYRVVTS
CCRCCCTVRLVVESGHAEIRQLQELLLGALHIVCPLCA
NT seq 297 nt   +upstreamnt  +downstreamnt
atgcatggccaacgaccaaccttaaaggacatatttctagagctggatcagcctgatgcg
gttgacctacattgtaacgagcaattagccagctcagaagaggaggataatagggaggac
ggtgagcaacctacacaacctacagaaccagcacagcaagcatatagggtggtaacaagt
tgttgtaggtgttgctgtacagtaaggctggtggtggagagtggacacgcagaaataaga
caactccaggagcttctgttgggcgcactgcatatagtgtgtccgctctgcgcataa

DBGET integrated database retrieval system