KEGG   Viruses: 9714824
Entry
9714824           CDS       T40000                                 

Symbol
S, BtCoVBM48_gp2
Name
(RefSeq) Bat coronavirus BM48-31/BGR/2008; spike protein
  KO
K24152  SARS coronavirus spike glycoprotein
Taxonomy
TAX:864596 [GN:T40376]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; unclassified Sarbecovirus
Organism
vg  Viruses (Bat coronavirus BM48-31/BGR/2008)
SSDB
Motif
Pfam: CoV_S2 bCoV_S1_N bCoV_S1_RBD CoV_S1_C CoV_S2_C BILBO1_N Fusion_gly SHE3 MukF_M GP41 Baculo_PEP_C DUF3418 RmuC CALM_bind TRPM_tetra DUF2959
Other DBs
NCBI-GeneID: 9714824
NCBI-ProteinID: YP_003858584
RS: NC_014470
UniProt: E0XIZ3
LinkDB
Position
NC_014470:21391..25170
AA seq 1259 aa
MKFLAFLCLLGFANAQDGKCGTLSNKSPSKLTQTPSSRRGFYYFDDIFRSSIRVLTTGHF
LPFNTNLTWYLTLKSNGKQRIYYDNPNINFGDGVYFGLTEKSNVFRGWIFGSTLDNTTQS
AVLFNNGTHIVIDVCNFNFCADPMFAVNSGQPYKTWIYTSAANCTYHRAHAFNISTNMNP
GKFKHFREHLFKNVDGFLYVYHNYEPIDLNSGFPSGFSVLKPILKLPFGLNITYVKAIMT
LFSSTQSNFDADASAYFVGHLKPLTMLVDFDENGTIIDAIDCSQDPLSELKCTTKSFTVE
KGIYQTSNFRVTPTTEVVRFPNITQLCPFNEVFNITSFPSVYAWERMRITNCVADYSVLY
NSSASFSTFQCYGVSPTKLNDLCFSSVYADYFVVKGDDVRQIAPAQTGVIADYNYKLPDD
FTGCVIAWNTNSLDSSNEFFYRRFRHGKIKPYGRDLSNVLFNPSGGTCSAEGLNCYKPLA
SYGFTQSSGIGFQPYRVVVLSFELLNAPATVCGPKQSTELVKNKCVNFNFNGLTGTGVLT
NSTKKFQPFQQFGRDVSDFTDSVRDPKTLEILDIAPCSYGGVSVITPGTNASSSVAVLYQ
DVNCTDVPTMLHADQISHDWRVYAFRNDGNIFQTQAGCLIGAAYDNSSYECDIPIGAGIC
AKYTNVSSTLVRSGGHSILAYTMSLGDNQDIVYSNNTIAIPMNFSISVTTEVLPVSMTKT
SVDCNMYICGDSTECSNLLLQYGSFCTQLNRALAGIAVEQDRNTRDVFAQTKAMYKTPSL
KDFGGFNFSQILPDPAKPSSRSFIEDLLYNKVTLADPGFMKQYGDCLGGVNARDLICAQK
FNGLTVLPPLLTDEMIAAYTAALISGTATAGFTFGAGAALQIPFAMQMAYRFNGIGVTQN
VLYENQKQIANQFNKAISQIQDSLSTTTTALGKLQDVINQNAIALNTLVKQLSSNFGAIS
SVLNDILSRLDKVEAEVQIDRLITGRLQSLQTYVTQQLIRAAEIRASANLAATKMSECVL
GQSKRVDFCGKGYHLMSFPQAAPHGVVFLHVTYVPSQEQNFTTAPAICHEGKAHFPREGV
FVTNGTHWFITQRNFYSPQPITTDNTFVSGNCDVVIGIVNNTVYDPLQPELDSFKEELDK
YFKNHTSQNVSLDGLNNINASVVDIKKEIEHLNEIAKSLNESLIDLQELGKYEQYIKWPW
YVWLGFIAGLIAIVMATIMLCCMTSCCSCLKGVCSCASCCKFDEDHSEPVLTGVKLHYT
NT seq 3780 nt   +upstreamnt  +downstreamnt
atgaaatttttggcttttctctgtcttcttggctttgctaacgctcaagatggcaagtgt
ggtacactatctaataaaagtccatctaagcttactcagactccttcttctaggaggggt
ttttattattttgatgacatttttaggtcttcaattcgtgtgcttaccactggccatttt
cttccttttaatactaaccttacttggtatttgactttaaagtctaatggtaagcagagg
atttattatgataatcccaacattaactttggtgatggtgtttattttggtctaaccgag
aaatctaatgtttttcgaggttggatttttggttcgacattagacaacacaactcagtct
gctgttctctttaataatggtacacacattgttatagatgtgtgtaactttaatttttgt
gctgatccaatgtttgctgtcaatagtggacagccttataaaacctggatttatactagt
gcggctaattgcacttaccacagagcacatgcatttaatattagcactaatatgaatcca
ggtaagtttaaacattttagggagcacctgtttaagaatgtagacggcttcctatatgtc
tatcataactatgaacccattgatcttaacagtggttttccttctggcttttctgtttta
aaaccaatacttaagctgccttttggtctcaacattacatatgttaaggccataatgaca
ttgttttcttccactcaaagtaattttgatgctgacgcttctgcttactttgtgggccat
ctaaaacctctcaccatgcttgttgactttgacgagaatggcaccattattgatgctata
gattgctctcaagatccactctcagagcttaagtgtaccactaagagttttacagttgaa
aaaggaatttatcaaacctctaacttccgtgttacaccaaccactgaagttgttaggttt
cctaacattacacagctttgtccttttaacgaagttttcaatataacctctttcccatcc
gtttacgcgtgggagagaatgcgcattactaattgtgttgcggactactcagtgctttac
aattcttctgcctccttctcaacatttcagtgttatggcgtttcacctacaaagctcaac
gatttatgctttagcagtgtttacgcagactactttgttgtgaagggtgatgatgtacgc
caaattgcacctgctcagacaggtgtgattgctgattacaattacaaattgcctgatgat
tttacaggttgtgtaatagcctggaatacaaattctttggacagttccaacgaattcttt
tacaggagattcagacatggaaagattaaaccttatgggcgtgacctttccaatgttctt
tttaacccttcaggtggtacatgttcagctgaaggtcttaattgttacaaaccacttgcc
tcctatggatttacacagtcctctggaattggctttcaaccatacagagtggttgtgctt
tcttttgagttgttaaacgcacctgctacagtttgtgggcctaaacagtctactgagcta
gttaagaacaagtgtgttaacttcaatttcaacggacttacaggcactggtgtgcttact
aattctactaaaaagttccaaccttttcaacagtttgggcgtgacgtttcagattttacg
gactccgtcagagaccctaaaacccttgagattcttgacattgcaccttgttcatacggc
ggtgtcagtgttataactcctggtacaaatgcttctagttcagtggctgttttgtatcag
gatgttaattgtacagatgtgcctactatgttacatgctgatcaaatttctcatgattgg
cgtgtgtatgccttccgtaatgatggcaacatattccaaacacaggctggttgtttgatt
ggtgctgcttatgacaactcatcttatgagtgtgatattcctataggagctggcatttgt
gctaagtatacgaatgtttctagcacacttgtgcgctccggtggacactccatactagct
tacaccatgtctcttggtgacaatcaagacattgtttattctaacaacaccattgctatt
ccaatgaattttagtattagtgtcactactgaggtcttgcctgtttcaatgactaagact
tcagtagattgtaacatgtatatttgcggtgactccactgaatgcagtaatttgctgcta
cagtatggtagtttctgcacgcagttaaacagagctcttgccggtatagctgtggaacaa
gacagaaatactcgagatgtctttgcacaaactaaggccatgtacaagactccttctttg
aaggattttggtggttttaatttttcacagattttgccagaccccgctaaaccgtctagt
agatcttttattgaggacttgctttacaacaaagtcacacttgctgacccaggttttatg
aagcagtatggtgattgtttaggtggtgttaatgctcgtgacctcatttgtgcacaaaag
ttcaatgggctcacagtactcccacccctactcactgatgaaatgattgcggcatacacg
gcagcactaataagtggaacggctacggcaggttttacttttggtgcaggtgctgcgctt
cagataccttttgcgatgcaaatggcttacagatttaatggcattggtgtcactcaaaat
gttttgtatgagaaccagaaacaaattgctaatcagttcaataaggctatctcacaaatt
caggattccttaagtactactactacagcacttggcaaattacaggatgtgattaaccaa
aatgccatagcccttaacacactagttaaacagcttagctccaattttggtgctatttct
agtgtactgaatgatattctgtctcgacttgacaaagtagaggccgaagttcaaattgac
aggcttataacaggacgtttacagagcttgcagacttatgttacacagcaacttatcaga
gccgcagaaattagagcctctgctaatcttgctgctacaaaaatgtccgagtgtgtactt
ggccagtctaagagagtagacttttgtggaaaaggatatcatttgatgtccttccctcag
gctgctcctcatggtgtagttttcttacatgttacttatgtaccatcgcaggaacaaaac
ttcactactgcacctgctatttgtcatgaaggtaaagcacactttcctcgtgaaggcgtc
ttcgtcacaaatggcacacactggtttatcactcagcgaaatttttattcgcctcagcct
attactacagacaatacatttgtgtcaggcaattgtgatgttgtcattggcattgttaat
aacactgtctacgacccactacagcctgaactagactcatttaaagaagaacttgacaag
tattttaaaaaccatacttcacagaatgttagtcttgatggtcttaacaacataaatgct
tcagttgtggacattaaaaaggaaattgaacatctcaatgagattgccaaaagcctaaat
gaatcactcatcgacctacaagaactaggcaagtatgagcagtacattaaatggccgtgg
tatgtgtggcttggctttattgccggtctcattgccatcgtcatggctacaattatgttg
tgttgcatgaccagctgttgtagttgtcttaaaggtgtttgctcatgtgcttcatgttgc
aaattcgatgaagaccactccgaaccagtgcttactggagtgaagttacattacacataa

DBGET integrated database retrieval system