KEGG   Viruses: 9714831
Entry
9714831           CDS       T40000                                 

Symbol
N, BtCoVBM48_gp9
Name
(RefSeq) Bat coronavirus BM48-31/BGR/2008; nucleocapsid
  KO
K24106  SARS coronavirus nucleocapsid protein
Taxonomy
TAX:864596 [GN:T40376]
  Lineage
Viruses; +ssRNA viruses; Riboviria; Orthornavirae; Pisuviricota; Pisoniviricetes; Nidovirales; Cornidovirineae; Coronaviridae; Orthocoronavirinae; Betacoronavirus; Sarbecovirus; unclassified Sarbecovirus
Organism
vg  Viruses (Bat coronavirus BM48-31/BGR/2008)
SSDB
Motif
Pfam: CoV_nucleocap
Other DBs
NCBI-GeneID: 9714831
NCBI-ProteinID: YP_003858591
RS: NC_014470
UniProt: E0XJ00
LinkDB
Position
NC_014470:27665..28918
AA seq 417 aa
MTDNGQSNSRNAPRITFGVSDTSDNNQNAERAGARPKQRRPQGPPNNTASWFTALTQHGK
EGLSFPRGQGVPVNTNSTRDDQIGYYRRATRRVRGGDGKMKELSPRWYFYYLGTGPEAAL
PYGANKDGIVWVATEGALNTPKDHIGTRNPNNNAAIVIQLPQGTTLPKGFYAEGSRGGSQ
ASSRSNSRSRGNSRNSTPSSSRGSSPARMAAGGDTALALLLLDRLNQLESKVSGKTPQQS
QVVTKKTAAEASKKPRQKRTATKAYNVTQAFGRRGPEPTQGNFGDQELIRLGTDYKNWPQ
IAQFAPSASAFFGMSRIGMEVTPTGTWLTYNGAIKLDDKDPNFKDQVILLNKHIDAYKTF
PPTEPKKDKKKKADEVQSLPQRQKKQATVTLLPAADLDDFSKQLQNSMNASPDSTQA
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgactgataatggacaatcaaactcgcgtaatgcgcctcgcattacgtttggtgtctca
gatacctcagacaataatcagaatgcagaacgtgctggagcgcggccaaagcaaagaaga
ccgcaaggccctcctaacaacacagcatcctggttcacagctctcactcagcatggtaaa
gaaggtctctcctttccgcgaggacagggagtgcccgttaataccaatagtaccagggac
gaccaaattggctactatcgcagagctacccgacgagttcgtggtggtgatggtaagatg
aaagaactcagcccgcgctggtacttctactatctaggaactggaccagaggccgcatta
ccttatggtgctaacaaagatggcatagtttgggtcgctacagaaggagccctaaacacg
cctaaagatcacattggcacgcgcaatcccaacaacaatgctgccattgtcatacagtta
ccacaaggtactaccttgccaaaaggcttctacgctgaaggaagtcgtggtggcagtcaa
gcctcctcgcgttctaactcacgtagccgtggtaattccagaaattcaacacctagcagc
agcagaggttcatcacctgcacgcatggctgccggaggagatacggcacttgcattattg
ctgttagacaggctgaaccagcttgagagcaaagtttcaggtaagacaccacaacaatca
caggttgtcacaaagaaaacagctgctgaggcttctaaaaagcccagacagaaaagaaca
gctaccaaagcctataatgttactcaggcttttggtaggcgaggtcccgaacctacacag
ggaaatttcggtgaccaggaattaatcagattaggtactgattacaaaaattggccacag
attgcacagtttgcacccagtgcttctgcattctttggcatgtcccgtataggaatggaa
gtcacacctacagggacttggttaacctataatggtgccataaaattggatgataaagac
ccaaatttcaaagaccaagttattctgcttaataagcacattgatgcttataagacattt
ccacctacagaacctaaaaaggacaagaagaaaaaggctgatgaagtacagtcactgccg
cagcgtcagaagaaacaggcaactgtgactctgttacctgcagcagatttggatgatttt
tccaaacaacttcagaattccatgaatgcttcacctgattctactcaggcctaa

DBGET integrated database retrieval system