KEGG   Viruses: 9829313
Entry
9829313           CDS       T40000                                 

Symbol
UL44, SaHV-1p13
Name
(RefSeq) Saimiriine alphaherpesvirus 1; envelope glycoprotein C
  KO
K19256  Simplexvirus envelope glycoprotein C
Taxonomy
TAX:10353
  Lineage
Viruses; dsDNA viruses; Duplodnaviria; Heunggongvirae; Peploviricota; Herviviricetes; Herpesvirales; Herpesviridae; Alphaherpesvirinae; Simplexvirus
Organism
vg  Viruses (Saimiriine alphaherpesvirus 1)
SSDB
Motif
Pfam: Marek_A C1-set
Other DBs
NCBI-GeneID: 9829313
NCBI-ProteinID: YP_003933796
RS: NC_014567
UniProt: E2IUC6
LinkDB
Position
NC_014567:complement(22003..23616)
AA seq 537 aa
MRWSIVAIAMSLCLWIAQSHPAGVIGKRRGSLARRPSRTRVASSEVASVVSDDAVRGDSA
AGNSSVAVAAPEAATPSVATETVDPERNDTEGDGSENISTVPVTPGVGHEDEPMVPTPSA
RVPDRGTPELDEKEEKPTPQSRPTPASPPTTPRKTSPISCDHEYMQTRMGTKMRMPCRIK
TDNASDVSRVRVVVYALEEDHEAQYRRISETPGAIQSGAQLVYDSQPEAPSTDIVPWAKG
AGPAETYPPLYSMSVHKGRWRLEIAAVEFENQGVYQWVYGEPAESGVAVLVTVFHPPRVS
LRSDPIVEGDLPKAVCSAVDYFPGTNSTTFEWFEDGVAVPPGDERVSTRVVSDRPEAFSA
ISTFASADPSQVGVEREFTCQVVWRRDSVSFSRMRATSRASVLPRPHVQIRLFEDRVECD
AACVPGNVTIAWTVDGVRAADTEAPENEGVCVAHPGTFRIRSTRSLTPGQCTYACGVVGY
PLSVSALERHVTRDPCEAPDSMESVVYALQLAGLLSGVLSAAALCAMLIARCVMSRK
NT seq 1614 nt   +upstreamnt  +downstreamnt
atgcggtggagcatcgtagccatagctatgtcgctgtgtctatggatagcgcagagccac
cccgcgggggtgatcgggaagagacgaggatcgctggctcggcgtccgtcgcgcacgcgc
gtcgcctcgagcgaagtcgcatcggtggtgtccgacgacgcggttcgcggcgattccgca
gccggcaacagctctgtggccgtggcggcgccagaagccgcgactccttcggttgccacg
gaaacggtagatcccgagaggaacgataccgaaggggatggctccgaaaacatctcgacc
gtccccgtcacaccgggggtaggacacgaagacgagccgatggtgcccacccccagcgca
cgcgttcccgaccgcggaacacccgagctcgacgagaaggaggaaaaacccacgccccaa
agcagacccactccggcctccccgcctaccacgccccggaagaccagtccgatctcttgc
gaccacgagtacatgcagactagaatggggacgaagatgaggatgccctgtaggatcaag
actgacaacgcctcggacgtgtcgcgagtgcgcgtcgtggtgtacgcgctagaagaagac
cacgaagcccagtaccggcgcatatccgagactcccggcgcgatccagtcgggcgcccag
ctggtgtacgacagccaaccggaggcgcccagcaccgacatcgtgccgtgggctaagggc
gctggcccggcggagacttaccccccgctgtactccatgtccgtccacaaaggccgctgg
cgcttagagatcgccgcggtagagtttgagaaccagggggtgtaccagtgggtctacggc
gaaccggcggagagcggagtcgccgtgctggtgacggtgttccaccctccgcgcgtgtcg
ctgcggtcggacccgatcgtggaaggcgacttacccaaggccgtctgctcggccgtcgac
tactttcctggcaccaacagcacgactttcgagtggttcgaggacggcgtcgccgtgccg
cccggagacgagcgcgtctcgacgcgcgtggtctcggatcggccggaagccttcagtgcc
atctcgactttcgcctccgccgacccgagccaggtcggagtcgagcgggagtttacgtgc
caggtcgtgtggcgcagagactccgtgtcgttctcccgcatgcgcgcgaccagccgggcg
tcggtcctcccgcgacctcacgtgcagatccggctcttcgaagaccgggtcgagtgcgac
gccgcttgcgtccccggcaacgtcaccatagcttggaccgtcgacggcgtccgcgcggcc
gacacagaggctcccgagaacgaaggggtgtgtgtggctcacccggggactttccgcatt
cgatccacacgctcgctgactccggggcagtgtacctacgcgtgcggcgtcgtcggatac
cccctgtccgtgtcggcgctggagcgccacgtgacgcgagatccatgcgaggcgccagac
tctatggagtccgtcgtctacgcgctgcagctcgccggcctgctgtctggggtcctcagc
gccgcagcgctgtgcgctatgctcatcgcccgctgtgtcatgtctagaaagtaa

DBGET integrated database retrieval system