KEGG   Virgibacillus halodenitrificans: BME96_04675
Entry
BME96_04675       CDS       T04548                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
vhl  Virgibacillus halodenitrificans
Brite
KEGG Orthology (KO) [BR:vhl00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vhl03000]
    BME96_04675
Transcription factors [BR:vhl03000]
 Prokaryotic type
  Other transcription factors
   Others
    BME96_04675
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: APC47506
LinkDB
Position
919568..920524
AA seq 318 aa
MKRVLFICISGILLVLLGGCNLYSRGELQAVGMLFDSPMEEQAWGKKGYKGLMAIQETEN
VDVYYKENIYTENDVALAVNEFVENGVNLIFGHSNSFGKYFKEIANDYPDVHFVYFNGNI
HSDNLTSLKFNGEAMGFFGGMVASKMTQTNQLGIIGAYEWQPEIEGFYEGAKYQNPAVDI
YIKILNTWVNRDLAIDIYKKMLGNDIDVFYPTGDSFSNEIIERSKRNDVHTIGYVDDQLK
LGKNTVLTSTVQHVDKLYEIAAERFDKGNLDGGVLTFDFGDGVISLGDFSPLVPESFQQE
IKESIQEYIETGKLPNAR
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaaacgagtacttttcatctgtataagtggaattttattagtgttacttggtggatgc
aatttatatagtagaggcgaactgcaggctgttggaatgctctttgatagtccaatggag
gagcaagcctgggggaagaaaggttataaaggcttaatggcaattcaggaaacagagaat
gtggatgtttactataaagaaaatatatatacagaaaacgatgttgcactagcggtaaat
gaatttgtggaaaatggggtaaatctaatttttggtcatagtaatagttttggtaaatat
tttaaagaaattgcaaatgattaccccgatgtccactttgtctattttaatggcaatatt
cattccgacaatttaacaagcttaaaatttaatggagaagctatgggtttttttggtgga
atggtggcaagtaaaatgacacagacaaatcaactgggaattataggtgcatatgaatgg
caacccgaaattgagggattctatgagggcgcaaaatatcaaaatcctgctgtagatatt
tatataaaaatattaaacacatgggtcaatagagacttagctatagatatttataagaag
atgcttggaaatgacattgatgtattttatccaacaggagattcgtttagtaatgaaatt
attgaaaggtcgaagaggaatgatgtccatacaatagggtatgtagatgatcaattgaag
ttagggaagaacactgttttaacaagcactgtacaacatgtggacaagctttatgaaatt
gcagcagagagatttgataagggaaatctcgatggtggggttcttacatttgattttggt
gatggcgttatatctctcggagatttcagtccacttgttcctgaaagctttcaacaagaa
atcaaagaatccattcaggaatacatagaaacagggaagctgccaaatgcccgctaa

DBGET integrated database retrieval system