KEGG   Virgibacillus phasianinus: CFK37_00595
Entry
CFK37_00595       CDS       T04951                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
vil  Virgibacillus phasianinus
Brite
KEGG Orthology (KO) [BR:vil00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vil03000]
    CFK37_00595
Transcription factors [BR:vil03000]
 Prokaryotic type
  Other transcription factors
   Others
    CFK37_00595
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: ASK60808
UniProt: A0A220TY77
LinkDB
Position
complement(117571..118542)
AA seq 323 aa
MECSRLKKLYVIFLATACLLIITVCNMYTKTGQIQNVGMLVEDSIHDQAWGHKGYKGLQS
IEKKFDVHVFYEEGVKTQQQVAEVVDKFVNNGVNLIFGHSNIYGKYFVNIAKSYPNVQFV
YFNGGYHAKNVTSLNFNSHAMGFFGGMIAGKMTDSNQVGIIAAYEWQPEIEGFYEGAKYQ
NPDVTVHIDYVKDWSDENTALIMYKKMKDMGVDVFYPTGDSYSKEVIKQASEDDLYAVGY
VTDQSNIDEETVLTSTVQHVDRLYTLAAEKFNSDKLKGDILVFDFQDDAITLGPFSSDIP
KDYVEKVENMIKEYKKTAILPNE
NT seq 972 nt   +upstreamnt  +downstreamnt
atggagtgcagccgcttgaaaaaattatacgtcatattcctagccacagcatgccttctt
atcataacagtgtgtaatatgtatacgaagacaggtcaaattcaaaacgtcggcatgttg
gtagaagattcgattcatgatcaggcatggggacataagggttataaaggcttgcaatcc
atcgaaaaaaagtttgatgtgcacgtattttatgaggagggtgttaagacccagcaacaa
gtagcagaagtcgtagataaatttgttaacaatggcgttaatttaatttttggccatagc
aatatttatgggaaatattttgtcaacatcgcgaaatcctatccaaatgtacaatttgtt
tattttaatggcggttatcatgcaaaaaatgttaccagtttgaattttaattctcatgcg
atgggtttctttggtggtatgatagctggaaaaatgacagattccaatcaagttggaatt
attgccgcttatgaatggcagcctgaaattgaaggtttttatgaaggggcaaaatatcag
aatccggatgtgaccgttcatattgattatgtcaaggactggagcgacgagaatactgcc
ttaattatgtataagaaaatgaaggatatgggtgttgatgttttttatccgacgggtgat
tcgtacagtaaagaagttattaagcaggctagtgaagatgatttatacgcggttggctac
gttacagatcagtccaatattgatgaggaaactgtattaacaagcacagtgcagcatgtt
gatagattgtatacattagctgcggaaaagtttaattcggacaagctgaagggtgacatt
cttgtgtttgactttcaggacgatgcaataacgctcggtccgttcagttccgatattcca
aaggattacgtggaaaaagtggaaaatatgataaaagagtacaagaaaacagcaatatta
ccgaatgaataa

DBGET integrated database retrieval system