KEGG   Virgibacillus sp. SK37: X953_05495
Entry
X953_05495        CDS       T03219                                 
Name
(GenBank) transcriptional regulator
  KO
K05519  transcriptional activator of comK gene
Organism
vir  Virgibacillus sp. SK37
Brite
KEGG Orthology (KO) [BR:vir00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vir03000]
    X953_05495
Transcription factors [BR:vir03000]
 Prokaryotic type
  Other transcription factors
   Others
    X953_05495
SSDB
Motif
Pfam: Bmp
Other DBs
NCBI-ProteinID: AIF42765
UniProt: A0A075JM09
LinkDB
Position
1030706..1031662
AA seq 318 aa
MKRVFFVCIIGVSLFLQAGCNLFSKGELQAVGMLFDSPMEEQAWGKKGYKGLMAIKETQD
VDVYYKENIYTENDVTLAVNEFVENGVNLIFGHSNSFGKYFKEIANDYPDVHFVYFNGNI
HSKNLTSLKFNGEAMGFFGGMVASKMTETNQLGIIGAYEWQPEIEGFYEGAKYQNPSVDI
YVKILNTWVNKDLAINIYTKMLANDIDVFYPTGDSFSNEVIERAKKADAHTIGYVDDQLK
LGKHTVLTSTVQHVDRLYEIAAERFDKGNLDGGILTFDFGDDAISLGEFSPIVPESFQQK
IKESIQEYKETGKLPNAR
NT seq 957 nt   +upstreamnt  +downstreamnt
atgaaaagagtttttttcgtctgtataattggagtttctttgtttttacaagctgggtgc
aatttatttagtaaaggcgagctgcaggctgttgggatgctctttgatagtccaatggag
gagcaagcctggggaaagaaaggctataaaggcttaatggcaattaaggaaacacaggat
gtggatgtatattataaagaaaatatttatacagaaaacgatgttaccctcgccgtaaat
gaatttgtggaaaatggggtaaatctgatttttggtcatagtaatagtttcggtaaatat
ttcaaagagattgcaaacgattatcctgatgtccactttgtttattttaatgggaacatt
cattccaaaaatttaacaagcttaaagtttaatggagaagccatgggtttttttggtgga
atggtagcaagtaaaatgacagaaactaatcagctggggattattggggcatatgaatgg
cagccagaaattgaagggttctacgaaggtgcgaaatatcaaaatccctctgtagatatt
tatgtaaaaatattaaacacatgggttaataaagacttagctataaatatttatacgaag
atgctcgcaaatgacatagatgtgttttatccaacaggtgattcgtttagtaatgaagtt
attgaaagggcgaagaaggccgatgcgcatacgatagggtatgtagatgatcaattaaag
ttaggcaagcatactgttttaacaagcactgtacagcatgtggacaggctatatgaaatt
gctgcagagagatttgataagggaaaccttgatggtgggatacttacatttgactttggc
gatgatgcaatatcgctcggtgaatttagtccaattgttcctgaaagctttcaacaaaaa
atcaaagaatccattcaggaatacaaggaaacaggaaagctgccaaacgcccgctaa

DBGET integrated database retrieval system