Vulpes lagopus (Arctic fox): 121497964 Help Entry 121497964         CDS       T07435                                  Symbol CALML5 Name (RefSeq) calmodulin-like protein 5   KO K02183   calmodulin Organism vlg  Vulpes lagopus (Arctic fox) Pathway vlg04014   Ras signaling pathway vlg04015   Rap1 signaling pathway vlg04020   Calcium signaling pathway vlg04022   cGMP-PKG signaling pathway vlg04024   cAMP signaling pathway vlg04070   Phosphatidylinositol signaling system vlg04114   Oocyte meiosis vlg04218   Cellular senescence vlg04261   Adrenergic signaling in cardiomyocytes vlg04270   Vascular smooth muscle contraction vlg04371   Apelin signaling pathway vlg04625   C-type lectin receptor signaling pathway vlg04713   Circadian entrainment vlg04720   Long-term potentiation vlg04722   Neurotrophin signaling pathway vlg04728   Dopaminergic synapse vlg04740   Olfactory transduction vlg04744   Phototransduction vlg04750   Inflammatory mediator regulation of TRP channels vlg04910   Insulin signaling pathway vlg04912   GnRH signaling pathway vlg04915   Estrogen signaling pathway vlg04916   Melanogenesis vlg04921   Oxytocin signaling pathway vlg04922   Glucagon signaling pathway vlg04924   Renin secretion vlg04925   Aldosterone synthesis and secretion vlg04970   Salivary secretion vlg04971   Gastric acid secretion vlg05010   Alzheimer disease vlg05012   Parkinson disease vlg05022   Pathways of neurodegeneration - multiple diseases vlg05031   Amphetamine addiction vlg05034   Alcoholism vlg05133   Pertussis vlg05152   Tuberculosis vlg05163   Human cytomegalovirus infection vlg05167   Kaposi sarcoma-associated herpesvirus infection vlg05170   Human immunodeficiency virus 1 infection vlg05200   Pathways in cancer vlg05214   Glioma vlg05417   Lipid and atherosclerosis vlg05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:vlg00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     121497964 (CALML5)    04015 Rap1 signaling pathway     121497964 (CALML5)    04371 Apelin signaling pathway     121497964 (CALML5)    04020 Calcium signaling pathway     121497964 (CALML5)    04070 Phosphatidylinositol signaling system     121497964 (CALML5)    04024 cAMP signaling pathway     121497964 (CALML5)    04022 cGMP-PKG signaling pathway     121497964 (CALML5)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     121497964 (CALML5)    04218 Cellular senescence     121497964 (CALML5)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     121497964 (CALML5)   09152 Endocrine system    04910 Insulin signaling pathway     121497964 (CALML5)    04922 Glucagon signaling pathway     121497964 (CALML5)    04912 GnRH signaling pathway     121497964 (CALML5)    04915 Estrogen signaling pathway     121497964 (CALML5)    04921 Oxytocin signaling pathway     121497964 (CALML5)    04916 Melanogenesis     121497964 (CALML5)    04924 Renin secretion     121497964 (CALML5)    04925 Aldosterone synthesis and secretion     121497964 (CALML5)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     121497964 (CALML5)    04270 Vascular smooth muscle contraction     121497964 (CALML5)   09154 Digestive system    04970 Salivary secretion     121497964 (CALML5)    04971 Gastric acid secretion     121497964 (CALML5)   09156 Nervous system    04728 Dopaminergic synapse     121497964 (CALML5)    04720 Long-term potentiation     121497964 (CALML5)    04722 Neurotrophin signaling pathway     121497964 (CALML5)   09157 Sensory system    04744 Phototransduction     121497964 (CALML5)    04740 Olfactory transduction     121497964 (CALML5)    04750 Inflammatory mediator regulation of TRP channels     121497964 (CALML5)   09159 Environmental adaptation    04713 Circadian entrainment     121497964 (CALML5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     121497964 (CALML5)   09162 Cancer: specific types    05214 Glioma     121497964 (CALML5)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     121497964 (CALML5)    05163 Human cytomegalovirus infection     121497964 (CALML5)    05167 Kaposi sarcoma-associated herpesvirus infection     121497964 (CALML5)   09171 Infectious disease: bacterial    05133 Pertussis     121497964 (CALML5)    05152 Tuberculosis     121497964 (CALML5)   09164 Neurodegenerative disease    05010 Alzheimer disease     121497964 (CALML5)    05012 Parkinson disease     121497964 (CALML5)    05022 Pathways of neurodegeneration - multiple diseases     121497964 (CALML5)   09165 Substance dependence    05031 Amphetamine addiction     121497964 (CALML5)    05034 Alcoholism     121497964 (CALML5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     121497964 (CALML5)    05418 Fluid shear stress and atherosclerosis     121497964 (CALML5)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vlg01009]     121497964 (CALML5)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vlg04131]     121497964 (CALML5)    03036 Chromosome and associated proteins [BR:vlg03036]     121497964 (CALML5)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vlg04147]     121497964 (CALML5) Protein phosphatases and associated proteins [BR:vlg01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      121497964 (CALML5) Membrane trafficking [BR:vlg04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     121497964 (CALML5) Chromosome and associated proteins [BR:vlg03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      121497964 (CALML5) Exosome [BR:vlg04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    121497964 (CALML5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 EF-hand_FSTL1 EF-hand_9 SPARC_Ca_bdg EH Dockerin_1 EF_EFCAB10_C EF-hand_EFHB_C EF-hand_STIM1 DUF5580_M FCaBP_EF-hand EF-hand_11 Temptin_C TerB SAPC2_N RPN13_C T2SSK ExbD SurA_N_3 SurA_N_2 COMM_HN DUF3008 RNase_H Motif Other DBs NCBI-GeneID:  121497964 NCBI-ProteinID:  XP_041623775 LinkDB All DBs Position 8:79730298..79731129 Genome browser AA seq 149 aa AA seqDB search MAEELPPEQVAKFKEVFSRFDKNGDNTINTQELGAVMQALGKDMSEAELKMLIAQVDTDG DGVISFQEFLEAMVKKMKSGGSEQEMREVFRAFDLNGDGHISVDELKQAMAKLGESLSQE ELDTMIQEADVDKDGQVNYEEFVRILSQK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaggagctgcctccagaacaggtggccaagttcaaggaagtcttctccagattt gacaagaacggtgacaacaccatcaacacccaggagctgggcgccgtgatgcaggccctg ggcaaggatatgtcagaggccgagctgaagatgctcatcgcccaggtggacacggacggc gacggggtcatcagcttccaagagttcctggaggcgatggtcaagaagatgaagtccggg ggcagtgagcaggagatgcgggaggtcttccgcgccttcgacctgaacggcgacggccac atcagcgtggacgagctcaagcaggccatggccaagctgggcgagtcgctgtcccaggag gagctggacaccatgatccaggaggccgatgtggacaaggacgggcaagtgaactacgaa gagttcgtgcgcatcctctcccagaagtga

DBGET integrated database retrieval system