KEGG   Virgibacillus necropolis: CFK40_16645
Entry
CFK40_16645       CDS       T04976                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
vne  Virgibacillus necropolis
Brite
KEGG Orthology (KO) [BR:vne00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:vne03000]
    CFK40_16645
Transcription factors [BR:vne03000]
 Prokaryotic type
  Other transcription factors
   Others
    CFK40_16645
SSDB
Motif
Pfam: Bmp LPAM_1
Other DBs
NCBI-ProteinID: ASN06527
UniProt: A0A221MFU5
LinkDB
Position
complement(3502381..3503340)
AA seq 319 aa
MLKKLYAIIFLISIFLVLSGCNEYIDTGQIQNVGMLTEGTIDDQVWGQKGYEGLQAIEKK
YDVNVYYKEGIKTQQEVTESVDELVSNGVNLIFGHSNIYGKYFVNISKSYPDVQFIYFNG
GYHAKNVTSLNFNSHAMGFFGGMVAGKMTETDQIGIVAAYEWQPEIEGFYEGAKYENPEV
KVHIDYVKDWADKDTAISMYKRMKEQNVDVFYPTGDSYSIDVIKQARKDGLYAIGYVSDQ
SYIDEETVLTSTVQQVDKLYTLAAKKFNKDELDGGILVFDFQDDVISLGTFSPVVPEDYQ
DKIEEIIKKYKKTALLPNE
NT seq 960 nt   +upstreamnt  +downstreamnt
atgttgaagaaattatacgccataatctttcttatatcaatctttctagtactttcaggg
tgtaacgagtacatcgacactggacaaattcaaaatgtaggcatgttgacagaaggcacg
attgatgatcaggtttggggacaaaagggctatgaaggcttgcaggcaatagagaaaaaa
tatgatgtcaatgtttattataaagagggtattaagacccagcaagaagttacagaatct
gtagatgaattagtaagtaatggcgttaatttaatttttggacatagtaacatttatggt
aaatattttgtaaacatttccaagtcctatcctgatgtacagttcatctattttaatggt
ggttatcatgctaaaaatgttacaagtttaaatttcaattctcatgctatgggtttcttc
ggcggtatggtagctggaaaaatgaccgaaacagatcagattggaattgttgcagcatat
gaatggcaacccgaaatagagggcttctatgaaggtgcaaaatatgagaaccctgaggtt
aaggtacatatagattatgtaaaggattgggcggacaaggataccgcaattagtatgtat
aaaagaatgaaagagcagaatgttgatgttttttacccaacaggtgattcgtacagtatc
gacgttattaaacaagcaaggaaagatggattatatgcaatcggatatgtttctgatcaa
tcttatattgatgaagaaactgttttaactagtactgttcaacaagtagacaagctctat
acattagctgcaaaaaaatttaataaagacgaacttgatggtggtattttggtttttgat
tttcaagatgatgtaatttcacttggtacatttagtccagtcgtaccagaagactatcaa
gataaaatagaagaaatcattaaaaaatataagaaaacagcgctattgccgaatgaatag

DBGET integrated database retrieval system