Vibrio neptunius: KW548_00535 Help Entry KW548_00535       CDS       T08906                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism vnp  Vibrio neptunius Pathway vnp02024   Quorum sensing vnp03018   RNA degradation vnp05111   Biofilm formation - Vibrio cholerae Brite KEGG Orthology (KO) [BR:vnp00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     KW548_00535 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     KW548_00535 (hfq)    05111 Biofilm formation - Vibrio cholerae     KW548_00535 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:vnp03019]     KW548_00535 (hfq)    03036 Chromosome and associated proteins [BR:vnp03036]     KW548_00535 (hfq) Messenger RNA biogenesis [BR:vnp03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      KW548_00535 (hfq) Chromosome and associated proteins [BR:vnp03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     KW548_00535 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QXX06693 LinkDB All DBs Position 1:complement(117197..117463) Genome browser AA seq 88 aa AA seqDB search MAKGQSLQDPFLNALRRERIPVSIYLVNGIKLQGQIESFDQFVILLKNTVNQMVYKHAIS TVVPARPVSHHSGERPQGGERQQEKSED NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttacaagacccattcttaaatgcattacgtcgtgaacgtatt cccgtatcaatctacctagtaaacggaattaaactacagggtcagattgagtctttcgat caatttgtgatcttgctgaaaaacaccgtcaaccagatggtatacaagcacgctatctcc acagtagtgcctgctcgtccagttagccaccatagtggtgagcgtcctcagggcggcgag cgtcagcaagagaaatcagaagattaa

DBGET integrated database retrieval system