KEGG   Vpept: 155971-1
Entry
155971-1          CDS       T49000                                 

Symbol
gp120
Name
(KEGG) HIV-1 surface protein gp120
  KO
K24266  HIV envelope glycoprotein gp120
Taxonomy
TAX:11676 [GN:T40001]
  Lineage
Viruses; ssRNA-RT viruses; Riboviria; Pararnavirae; Artverviricota; Revtraviricetes; Ortervirales; Retroviridae; Orthoretrovirinae; Lentivirus
Organism
vp  Virus mature peptides
SSDB
Motif
Pfam: GP120
Other DBs
NCBI-ProteinID: NP_579894 NP_057856
GB: NC_001802
LinkDB
AA seq 479 aa
KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTEN
FNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKG
EIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEP
IPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVI
RSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCN
ISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFN
STWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGL
LLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR
Comment
vg:155971 33..511

DBGET integrated database retrieval system