Vicugna pacos (alpaca): 102539182 Help Entry 102539182         CDS       T08098                                  Symbol PRLH Name (RefSeq) prolactin-releasing peptide   KO K05269   Prolactin-releasing peptide Organism vpc  Vicugna pacos (alpaca) Pathway vpc04080   Neuroactive ligand-receptor interaction Brite KEGG Orthology (KO) [BR:vpc00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     102539182 (PRLH)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:vpc04052]     102539182 (PRLH) Cytokines and neuropeptides [BR:vpc04052]  Neuropeptides   Neuropeptides (GPCR binding)    102539182 (PRLH) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Prolactin_RP LEAP-2 Motif Other DBs NCBI-GeneID:  102539182 NCBI-ProteinID:  XP_006209204 UniProt:  A0A6I9IFH9 LinkDB All DBs Position 5 AA seq 87 aa AA seqDB search MKALRAWLLCLLLLGLALRGAASRAHQHSMEIRTPDINPAWYTGRRIRPVGRFGRRRAAL RDVPKPGFWHLPACFPLEGGAEPAQGD NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgaaggcgctgcgggcctggctgctgtgcctgctgctgctgggcctggccctgcggggg gcggccagccgcgcccaccagcactccatggagatccgcacccctgacatcaacccggcc tggtacacgggccgcagaatccggcccgtgggccgcttcggccggaggagagcagccctg agggatgtcccgaagcctggcttctggcacctgccagcctgcttccccctggagggaggt gctgagcccgcccagggtgactga

DBGET integrated database retrieval system