Variovorax paradoxus B4: VAPA_1c23720 Help Entry VAPA_1c23720      CDS       T02835                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism vpd  Variovorax paradoxus B4 Pathway vpd02024   Quorum sensing vpd03018   RNA degradation Brite KEGG Orthology (KO) [BR:vpd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     VAPA_1c23720 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     VAPA_1c23720 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:vpd03019]     VAPA_1c23720 (hfq)    03036 Chromosome and associated proteins [BR:vpd03036]     VAPA_1c23720 (hfq) Messenger RNA biogenesis [BR:vpd03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      VAPA_1c23720 (hfq) Chromosome and associated proteins [BR:vpd03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     VAPA_1c23720 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  AGU49474 UniProt:  T1XAW7 LinkDB All DBs Position 1:2534493..2534738 Genome browser AA seq 81 aa AA seqDB search MSNKGQLLQDPFLNTLRREHVPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAI STIVPGRAVNFSAAENDDAAA NT seq 246 nt NT seq  +upstreamnt  +downstreamnt gtgagcaataaagggcaacttctacaagacccgtttctgaacaccctgcgtcgcgagcat gtgccggtctccatttatctggtgaacggtatcaagctgcagggccagatcgagtctttc gaccagtacgtcgtgttgcttcgcaacacggtgacgcaaatggtctacaagcacgccatc tccaccatcgtgccgggtcgtgccgtcaacttctcggctgccgagaacgacgacgccgca gcctga

DBGET integrated database retrieval system