KEGG   Vanderwaltozyma polyspora: Kpol_1002p57
Entry
Kpol_1002p57      CDS       T01049                                 
Name
(RefSeq) hypothetical protein
  KO
K06663  DNA damage checkpoint protein
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo04111  Cell cycle - yeast
vpo04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    Kpol_1002p57
   04113 Meiosis - yeast
    Kpol_1002p57
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:vpo03400]
    Kpol_1002p57
DNA repair and recombination proteins [BR:vpo03400]
 Eukaryotic type
  Check point factors
   Rad17-Mec3-Ddc1 complex
    Kpol_1002p57
SSDB
Motif
Pfam: Rad9
Other DBs
NCBI-GeneID: 5547760
NCBI-ProteinID: XP_001647268
UniProt: A7TE88
LinkDB
AA seq 579 aa
MSFRATVVGTQNQILWFKSLNALYNIREQISFSITSNDVTISAMNDSDTSLCQVTFQKDF
FQDFEFKPNEIVFGEEGLQVITDAKGTYHRIYSFNVNGKHLAIISKVSGNDVIKSFTLKI
NNTSTCPEIFTNRLLVEIEMESAMIKEYTPQISPTKYEPVMINLNYKKKFLDVYSTAPTP
ERPLDSKLLEVFRNIESQLDRSIFDINLVSGVNDKNKLTSDDEINYFCCHQTLFRNFLEN
CNPAITDNIKLEININRLTITAYSKSIQDQNKDLLKNAISMSNTISTSSLDNYCLFTTIN
DDIERETMKKHPMKSIIYYLKDFKNFIGITSAPKNSISNNDNISVWFCRPGFPILMEMKR
PGVTFQLAEVTISTDNKFETPVNSSPTKGKVIKVSVSPEKLDNQGRYGKLQPNQKPEPIS
PTKELRLKSEGIITGNRYNSSHKIVPRELKKAAQKLFVEDASQDDDFVDVNSHSNDKHNT
DQHKEDLDTLNRNNFNIDTTNNEPIAERHGTTIGWGKRTNEMREEQESPTIAKTSNQDSA
MDKENSNTRNETPRLKQPKNELDLGFGPTQPDTPKGLFD
NT seq 1740 nt   +upstreamnt  +downstreamnt
atgtcttttcgagccactgttgttggtacgcagaatcaaattttatggtttaaatcgctt
aatgccctgtataatataagggaacaaattagttttagtataacatctaatgacgttaca
atctctgcaatgaatgattcggatacttcattatgtcaagtaacatttcaaaaggatttt
ttccaagatttcgagtttaaacctaatgaaattgtatttggtgaagaagggttacaagtg
attactgatgctaagggtacctaccataggatttatagttttaatgtcaatggcaaacat
ttggcaattatttctaaagtttctggaaatgatgtaattaagagtttcactttaaagatc
aataatacatcaacatgccctgaaatttttacaaatagattactggtcgaaatagagatg
gaatctgcaatgataaaggaatatacaccacagatatcaccaactaaatatgaacctgtg
atgattaatttaaattacaagaaaaagttcttagatgtttatagtactgcacctacccca
gaaagaccattggattcaaaattactcgaagtctttagaaacattgaaagtcaattagat
cgttctatatttgatatcaatctagtatcaggcgttaatgataaaaataaattaacttcg
gatgatgaaatcaattacttctgttgccatcaaactttattcagaaactttttagaaaat
tgtaatcctgcaattactgataatattaaattggaaataaatatcaaccgtttgacaata
acagcttattcgaaatctatccaagatcaaaacaaggatttattaaaaaatgcaataagc
atgagcaacacaatcagtacttcttcattggataattactgtttattcaccacaattaat
gacgacatagagagagaaacaatgaagaaacatccaatgaaaagcataatttattatcta
aaagatttcaaaaatttcattgggattacttctgcaccaaagaattctatatccaacaat
gacaatattagcgtttggttctgtcgccctgggttcccaatattaatggaaatgaaaagg
cctggagtgactttccaattagctgaagtaacgatttcaactgataataaattcgaaact
ccagtaaatagctctccaactaagggtaaagtaataaaggtttctgtttctccagaaaaa
ctagataaccaagggaggtatggtaaactacaaccgaatcaaaagccggagcctataagt
ccaacaaaggaattacgtctgaaatcagaaggaataatcacagggaaccgttataacagc
tcacataaaatagttccaagagagttaaaaaaggcagcgcaaaagctatttgtggaggat
gcatctcaagatgatgactttgttgatgtcaatagtcattctaatgacaaacacaatact
gatcaacataaggaagacttagacacactcaatagaaataattttaatatagacacgact
aacaatgaaccaattgctgaaagacatggaaccacaattggctggggtaaacgaactaac
gagatgagagaagaacaagagtcaccaacaatagctaaaacatctaatcaagatagcgca
atggataaggaaaattcaaatacgaggaacgaaacaccaagacttaaacaaccaaaaaac
gaattggatcttggttttggtccaacgcaacctgatacacccaagggtttattcgattaa

DBGET integrated database retrieval system