KEGG   Vanderwaltozyma polyspora: Kpol_1012p2
Entry
Kpol_1012p2       CDS       T01049                                 
Name
(RefSeq) hypothetical protein
  KO
K12414  DNA replication licensing factor, required for pre-replication complex assembly
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo04111  Cell cycle - yeast
vpo04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    Kpol_1012p2
   04113 Meiosis - yeast
    Kpol_1012p2
SSDB
Motif
Pfam: CDT1_C CDT1 FAM220
Other DBs
NCBI-GeneID: 5542916
NCBI-ProteinID: XP_001642733
UniProt: A7TS76
LinkDB
AA seq 589 aa
MESSRKIHFPTIDLDEISEESDLLQVVKSILIRYDTFLLKNFAGKDKLETFLDQLEVSKP
EKTNGFDSSFTGTHEIKQNSDIIIEQYIFNTDESLQFDRECDNIILRKVYNRLFKLTLFF
ANLCLKCLDKEVLLDQENYASRITRYYNDTSDDLEQLLPDSESFQYFLSHDFEPFTSAGI
LTIFPRATGIKCKPSTISTDDNRWVQIDEPDCMLIHTGSLMNLWSDGKYTTSPMMIDHHS
NLTHLTMFPPLGTPVNNDTVGGVMLGQLLEEYPVVAKKYYKGEMALKELKKRIQFYKQLF
ISTETVLSLYSMAKIHHSAADVIDLLPLISNMMKKKIVEDSFLRMVTIWPQCYNLEMSSS
GELRIRFNKVNPLAIFTDNRRREQFITKADEWLEQAEMEDSIPLDVEPFKLSKRILDHKD
LDTSRKLEEEKEKIDVSYENTSLTKRRYISNTSEEVGFKEKKHTSQADILSKLRERERNS
SKLLSQRQKQYQKFLHVKMKHVFEILHSIEGNKPYTMTVLSTLVVDSLRDGNNPIGTSEA
QEILLKLQNLLPDEIIVNEVDGGLKVFKWNNLNRELFKKKIEDDLNNNE
NT seq 1770 nt   +upstreamnt  +downstreamnt
atggaatcctctagaaaaattcattttcctacgattgatttagacgaaatatcagaagaa
tctgatttattgcaagtagttaaatccattttaataagatatgacacttttttgttgaaa
aattttgcaggtaaagataagttagaaacctttttggatcagctagaggttagtaaacca
gaaaaaactaatggattcgattcaagctttactggaactcatgaaattaaacagaactcc
gatatcattattgaacaatatatctttaatactgatgaaagtttacagttcgatagagag
tgtgataatataattctgagaaaagtttacaacagattgttcaaattgactttgttcttt
gccaacctctgtttaaaatgtctggataaagaagtactattggatcaagaaaattatgcg
tcaaggattacacgttattataatgatacatccgatgatttagaacaattgttaccagat
agtgaaagtttccaatactttttatctcatgattttgaaccattcacctctgccggtata
ttgactatattcccacgagctacagggataaaatgcaagccctctactataagtactgac
gataacagatgggtacagattgatgagccagattgtatgttgatccatactggttctctt
atgaatttatggtcggatggaaaatatacaacatctcctatgatgattgatcatcatagc
aatttgactcatttgaccatgttcccacctttgggtactccagttaataatgacacagtc
ggcggagttatgcttggtcaattgcttgaagaatatccagtggttgcgaaaaaatattac
aaaggggaaatggctttaaaggaattgaaaaaaagaattcaattttacaaacaattattt
atatccactgagactgtactgtcactttactctatggctaaaatacaccactctgccgct
gacgttatcgatttacttccattgatttcaaatatgatgaaaaagaaaatagtggaggat
tcctttttaaggatggtgacaatatggcctcaatgctacaatttagaaatgagttctagc
ggagaattgagaatcagatttaataaggtaaacccattggctatatttactgataatcgt
agaagagaacaatttataacaaaagcagatgaatggttagaacaagctgaaatggaagat
tctattccgttagatgttgaaccatttaagttatccaaaagaattttagatcataaagat
ttagatactagtagaaagttagaggaagaaaaggaaaaaattgacgtatcttatgaaaat
acttcgctaacaaaaagaagatatatttctaatacatcagaagaagtaggcttcaaagaa
aagaagcacacttctcaagcagatatattaagcaagcttcgagaacgtgaaagaaattcg
tctaaattgttatcacaacgccaaaagcagtatcaaaaattcttgcatgttaaaatgaag
catgtttttgaaatcttgcattctattgaaggcaataagccctatacaatgactgtactg
agtacactggtagtggacagtttaagggatggtaataatcccattggcacgtcggaggct
caagaaattttattaaaacttcaaaaccttcttccagatgaaataatagttaatgaagtt
gatggaggtcttaaagtgttcaaatggaacaatctaaatagggaattgttcaagaaaaag
atagaagatgatctgaacaataacgaatga

DBGET integrated database retrieval system