Vanderwaltozyma polyspora: Kpol_460p3 Help Entry Kpol_460p3        CDS       T01049                                  Name (RefSeq) hypothetical protein   KO K12691   dolichyl-diphosphooligosaccharide---protein glycosyltransferase subunit 5 Organism vpo  Vanderwaltozyma polyspora Pathway vpo00510   N-Glycan biosynthesis vpo00513   Various types of N-glycan biosynthesis vpo01100   Metabolic pathways vpo04141   Protein processing in endoplasmic reticulum Module vpo_M00072   N-glycosylation by oligosaccharyltransferase Brite KEGG Orthology (KO) [BR:vpo00001]  09100 Metabolism   09107 Glycan biosynthesis and metabolism    00510 N-Glycan biosynthesis     Kpol_460p3    00513 Various types of N-glycan biosynthesis     Kpol_460p3  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     Kpol_460p3 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ost5 DUF6594 DUF6585 DUF4064 Motif Other DBs NCBI-GeneID:  5543460 NCBI-ProteinID:  XP_001643226 UniProt:  A7TQR9 LinkDB All DBs AA seq 87 aa AA seqDB search MSYEQLYNEYTLSRAFEPVFALESQPTMAIVASLISLVLVSLSILVMKSKNHSIVVKFII FSIISAIASLFCGITTVFTTNSFGVYV NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgagttatgaacagttatataatgaatacaccttaagcagagcttttgaacctgttttc gctttggaatctcagccaacaatggcaattgttgctagtttgatatctttagtattggtt tcattatctattcttgtaatgaagtctaagaatcattctattgttgttaaatttataatc ttctcgattatcagtgcaattgcttctttattctgtggtataacaacagtattcacaaca aactcatttggtgtctatgtttga

DBGET integrated database retrieval system