KEGG   Vanderwaltozyma polyspora: Kpol_479p3
Entry
Kpol_479p3        CDS       T01049                                 
Name
(RefSeq) hypothetical protein
  KO
K12575  kinetochore protein SLK19
Organism
vpo  Vanderwaltozyma polyspora
Pathway
vpo04111  Cell cycle - yeast
vpo04113  Meiosis - yeast
Brite
KEGG Orthology (KO) [BR:vpo00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04111 Cell cycle - yeast
    Kpol_479p3
   04113 Meiosis - yeast
    Kpol_479p3
SSDB
Motif
Pfam: Fungal_TACC SRF-TF Filament Crescentin
Other DBs
NCBI-GeneID: 5543621
NCBI-ProteinID: XP_001643373
UniProt: A7TQB6
LinkDB
AA seq 795 aa
MDSFPTTPVNKMILGHQETSDLGSTSNGNDGEFKVHPHGLSSKKRFVHSGVESASETDLS
LDCVRRSVNPETSEKARKEILDNMDINKLFSKSRDVSSADDISNGPMIKLIHSPVKVDLS
SPVPVTANGIDKAENEEHVSKKPRLELDFAPDLKKPITNDSEEIVGSPDAIEMIETKSSP
NKTGQNEELLALEIQEAMRVSIHEEESEDDKEDNNSKDVSHKSFVTPKKDDVETSPNLHK
LTPLLSSSSSSLSPKMEYRHICSGEQDEIEKEHNGFILVSRRNEELIDQLHMMNKRLNNY
LSKYENSNYQYKLLRAEHEKAKDNFEKQLNLAQAEVDQSTEDANKHKERFEKIKKKLSET
KDEIQMLNQNQRILQDKYDGMANEVDEWRNKYEEVQGKMAKQENEANNSASKLQLLEDEL
EILKNKLDEYEASETKLKLDYKELDELFQKREEELFSKANEVNTLQQSLNEIMNSQKSAS
EDLVKQIEELSTSKSQLEVKLSQISVDHSKEKHYLEDKINGMEKDLSENVGKLEIANQKI
SDLQIKLNGEIQNLANLKKEYEVSNDDAEINKAEVQQLNTNIEELKESEIHLKEKISTLE
ANIEEWKGKYQAQSSAHEKVSIEFESLQLKNNNIEAEHLAELEQLHDNMTSLQDTMKENA
ESINKLKDENRILQEKLLANEEVTSNSQTSSEVKEQEINELKNKIKDFQEKLDLKEQDTN
KRLKLLAEDLYVQYSSKHEQKVKLLKKGYDTKYQSKIDQISLQNQGLVQEIEQIKNQLST
ERKEKQKLLELLDQK
NT seq 2388 nt   +upstreamnt  +downstreamnt
atggattcttttcctacaacaccagttaataaaatgattttggggcatcaagagacttca
gatcttgggtctacatctaatggtaatgatggtgaatttaaagttcatcctcatggcctt
tcgagtaagaagaggtttgttcattcaggggttgagtctgcttctgaaactgatttatcg
ttagattgtgttaggaggagtgtcaatcctgaaacatctgaaaaggctagaaaggaaata
ttggataatatggatattaataaattgttttctaaatctagggatgttagtagtgctgat
gatatttccaatggtccgatgataaaattaattcattctccagtaaaagtggatttaagt
tctccagtaccagtaaccgccaatggaattgacaaagcagaaaacgaagaacatgtttct
aaaaagccaagattagaattagactttgctccagacttgaagaaacctatcactaatgat
agtgaagaaattgtaggatcgcctgatgccattgaaatgatcgagactaaaagtagtcca
aataaaacaggtcagaatgaagaattgctagcattggaaattcaagaggctatgagagta
tcaatccatgaggaagaatctgaagatgataaagaggataacaatagcaaagatgtttca
cacaagagctttgttactccaaagaaggatgatgtcgaaacttctccaaatcttcataaa
ttgacaccactcttaagtagcagcagcagcagtctatcaccaaaaatggagtatagacat
atatgcagtggagaacaagatgaaatcgaaaaggaacataatgggtttattttagtttca
agaagaaatgaagagttgattgatcaactacatatgatgaacaaaagattaaacaactat
ctttccaaatatgaaaattcaaactatcagtataaacttttgcgtgcagagcatgaaaag
gcaaaagataattttgagaagcaattgaatttagcacaagctgaagttgatcagtcaact
gaagatgctaataaacataaagagagatttgagaaaattaagaagaaactaagtgagaca
aaggatgaaatccaaatgctaaatcaaaatcaacgtattttgcaagataaatatgatgga
atggcaaacgaagtcgatgaatggagaaataagtatgaagaagtccaagggaagatggcg
aaacaggaaaatgaggcaaataatagtgcatcaaagctgcaattacttgaagatgaatta
gaaatattgaagaataaattagatgaatatgaggcaagcgaaactaagttaaagctggat
tacaaagagttagatgaacttttccaaaagagagaggaagagttattttcaaaagcaaac
gaagttaataccctacagcaaagcctaaatgaaataatgaatagtcaaaagagcgccagt
gaagacttagtaaaacagattgaagagttatctacttcaaaatctcaattagaagtaaaa
ttaagtcaaatatcagtcgatcactcgaaggagaaacattacctagaggataaaattaat
ggaatggaaaaagatctttcagaaaatgttggaaaattggaaattgctaaccagaaaata
tcggatcttcaaattaaattaaatggggaaattcaaaatttagctaatttaaagaaagaa
tacgaagtgtcaaatgacgatgcagaaatcaataaggctgaagtacagcaattaaatacc
aatattgaagaattaaaggaaagtgagattcatttgaaagagaaaatatctacactggag
gcgaatatcgaagaatggaagggaaaatatcaagctcaatctagcgcccatgaaaaagta
tccatagaatttgaaagtttacaattgaaaaataacaatatagaagctgaacatttagca
gaattagaacaattacatgataatatgacatcattacaagatactatgaaagaaaatgca
gagtcaattaataaattaaaagatgaaaacagaatattacaagaaaagttattagctaat
gaagaagtgacaagcaattcacaaacctcaagtgaagtaaaagaacaagaaataaacgaa
ttgaaaaataaaataaaagatttccaagagaaattagatcttaaagaacaagatacaaac
aaacgtttaaaattgttggcagaagatttatatgtccaatattcttcaaagcatgaacaa
aaagtcaaattattgaaaaaaggttacgatacaaaatatcaatcaaaaattgatcaaata
tcattacaaaatcaaggattagtccaagagattgaacaaataaagaatcaactttccaca
gagaggaaagaaaagcaaaaattattagaactcctagaccaaaaataa

DBGET integrated database retrieval system