KEGG   Vespula pensylvanica (western yellowjacket): 122636493
Entry
122636493         CDS       T07720                                 
Name
(RefSeq) cytochrome P450 306a1 isoform X1
  KO
K10720  ecdysteroid 25-hydroxylase [EC:1.14.-.-]
Organism
vps  Vespula pensylvanica (western yellowjacket)
Pathway
vps00981  Insect hormone biosynthesis
Brite
KEGG Orthology (KO) [BR:vps00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00981 Insect hormone biosynthesis
    122636493
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:vps00199]
    122636493
Enzymes [BR:vps01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.-
    1.14.-.-
     122636493
Cytochrome P450 [BR:vps00199]
 Cytochrome P450, animal type
  CYP306 family
   122636493
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 122636493
NCBI-ProteinID: XP_043683693
LinkDB
Position
22:2426411..2442856
AA seq 523 aa
MKQTLSDLSTFRRKSSLQSDRISSRYLGTFKMSIFMIVIAFMLLTILYYMSRKKHRLPPG
PLGLPIVGYLPWIDPKAPHETLTELTRKYGPICGLKMGSVYTVLLSDPRLIRQVFAKDTF
AGRAPLYLTHGMMHGYGLICAEGELWRDQRRFVAGCLKNLGMVKFGLKRDRMERRILAVL
EECISKLKERSTIDGFDPNETLQHCIGNLMNDLVFGKTYDENDRVWNWLRMLQEEGVKHI
GVAGPLNFLPFLRFLPWYGKTMYTLIDGKEKTHKIYKSIVEEHRSNPVKMESLLAAFDDE
MTSRMKSDDLGYFTEKQFYHLLADIFGAGMDTTLTTLRWFLLFVATYPDEQEKIYQEMQQ
VLPDKEPTLDDRTVLTRLEAAIAEVQRIRSVVPVGIPHGTIEDTQIGDYDIPKGTMVVPM
QWSIHTDPSYWQDPFDFKPDRFIADDGSLVKPEAFLPFQTGKRMCVGDELARMILFLFSS
RIIRRFVVSIPPNVSINLEGECGITLVPKPHRLVFALRECPGI
NT seq 1572 nt   +upstreamnt  +downstreamnt
atgaaacaaacgctttcagacctttccacattccgcagaaaatcatcgttacagagtgat
cgcatctcaagccgataccttggaacgtttaagatgtcgatatttatgatcgtaatagct
ttcatgctcctaacgatcttatattacatgagtcgaaagaaacatcgattaccacctggc
cctttaggcctaccgatcgtgggctatttgccatggatcgatccaaaagcacctcatgag
acacttaccgaattgacaaggaagtatggaccgatctgtggattgaaaatgggttctgta
tacactgtacttttatcggatcctcgtctgatacgacaagtcttcgctaaggatacgttt
gctggacgggcaccactctacttgacgcatggcatgatgcatggttatggtctcatctgc
gccgagggagagctctggagggatcaaagaagattcgtcgctggttgtttgaaaaatctc
ggcatggtaaaattcggactgaaaagggacaggatggaaaggagaatcctcgcagttctg
gaagaatgcatttcgaaattgaaggaaagatctacgatcgacggtttcgatccaaacgag
actttgcaacattgtataggaaatctgatgaacgatctcgtgttcggtaaaacgtacgac
gagaacgatcgcgtttggaattggcttcgtatgttacaagaagaaggtgtgaaacatatt
ggtgttgccgggcctttaaattttttaccatttctcagatttttaccatggtacggtaaa
acgatgtatactttgatcgatggaaaagaaaagacccataagatttataagagcatcgtc
gaggaacatcgatctaatcccgtaaaaatggagagtcttttggcagcgttcgacgatgaa
atgacgagtagaatgaagtcggacgaccttggatattttaccgaaaagcaattctatcat
ttgctcgctgacattttcggtgcaggaatggacacgaccttgactactctccgttggttc
cttctcttcgttgcgacttatccggacgaacaggaaaagatctatcaagagatgcaacag
gtgctaccagataaagaacccactttagacgatagaactgttttgacgcgtctcgaggca
gctatagcggaagtacaaaggataagaagcgttgttccagttggtatacctcacggaacg
atcgaggatacgcaaataggagactacgatataccaaaaggtacgatggtggtaccgatg
caatggtccattcataccgatccatcttattggcaagacccattcgattttaaaccggat
agattcattgccgatgatggcagcctcgttaagccggaagcgttcttgcctttccaaact
ggaaaacgtatgtgcgtcggggacgaacttgccaggatgatcctgttccttttctcttcg
agaataatccgtagattcgtcgtttcgatccctcctaacgtttcgattaatctcgaagga
gaatgcggtattacgttggtccctaaaccccatagattggttttcgcacttcgtgaatgc
cctggaatatga

DBGET integrated database retrieval system