Vigna radiata (mung bean): 106757626 Help Entry 106757626         CDS       T04126                                  Name (RefSeq) calmodulin-3   KO K02183   calmodulin Organism vra  Vigna radiata (mung bean) Pathway vra04016   MAPK signaling pathway - plant vra04070   Phosphatidylinositol signaling system vra04075   Plant hormone signal transduction vra04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:vra00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     106757626    04070 Phosphatidylinositol signaling system     106757626    04075 Plant hormone signal transduction     106757626  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     106757626  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vra01009]     106757626   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vra04131]     106757626    03036 Chromosome and associated proteins [BR:vra03036]     106757626   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vra04147]     106757626 Protein phosphatases and associated proteins [BR:vra01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      106757626 Membrane trafficking [BR:vra04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     106757626 Chromosome and associated proteins [BR:vra03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      106757626 Exosome [BR:vra04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    106757626 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 EF-hand_FSTL1 AIF-1 SPARC_Ca_bdg EH EF-hand_EFHB_C Dockerin_1 SAPC2_N TerB EF_EFCAB10_C DUF5580_M EF-hand_STIM1 Motif Other DBs NCBI-GeneID:  106757626 NCBI-ProteinID:  XP_014495828 UniProt:  A0A1S3TPX6 LinkDB All DBs Position 3:complement(1614770..1615557) Genome browser AA seq 148 aa AA seqDB search MAGAMTDDQIAEFQEAFCLIDKDCDGFISVDELTAVFRSIVGNPTKEEIQDMISEVDLDG NGSIDFEEFLNIMSRKMKETLSEELKEAFKVFDRDQDGYISAIELRHVMMNMGERLTDEE AEQMIREADLDGDGQVSFDEFARIMMLK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggcaggtgcaatgacagatgatcaaatagctgaattccaagaagccttttgcctcatt gacaaggattgtgatggattcattagcgtggacgaattgacagccgttttccgatcaata gtagggaacccgacaaaagaagaaatccaagacatgatcagtgaagtggacctcgatggg aatggaagtatagattttgaggagttcttgaatattatgagtagaaaaatgaaggaaact ttatctgaagagctgaaagaagccttcaaagtgtttgatagagatcaagacggatacata tctgccattgagctgaggcatgtgatgatgaatatgggagagaggctgacagacgaagag gcagaacaaatgattagagaggcagatttggatggggatgggcaagttagctttgacgaa tttgcaaggattatgatgctcaaatga

DBGET integrated database retrieval system