Vibrio ruber: RND59_08535 Help Entry RND59_08535       CDS       T09542                                  Symbol folA Name (GenBank) type 3 dihydrofolate reductase   KO K00287   dihydrofolate reductase [EC:1.5.1.3] Organism vru  Vibrio ruber Pathway vru00670   One carbon pool by folate vru00790   Folate biosynthesis vru01100   Metabolic pathways vru01240   Biosynthesis of cofactors vru04981   Folate transport and metabolism Module vru_M00126   Tetrahydrofolate biosynthesis, GTP => THF Brite KEGG Orthology (KO) [BR:vru00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     RND59_08535 (folA)    00670 One carbon pool by folate     RND59_08535 (folA)  09150 Organismal Systems   09154 Digestive system    04981 Folate transport and metabolism     RND59_08535 (folA) Enzymes [BR:vru01000]  1. Oxidoreductases   1.5  Acting on the CH-NH group of donors    1.5.1  With NAD+ or NADP+ as acceptor     1.5.1.3  dihydrofolate reductase      RND59_08535 (folA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DHFR_1 Motif Other DBs NCBI-ProteinID:  WNJ94227 LinkDB All DBs Position 1:1876696..1877184 Genome browser AA seq 162 aa AA seqDB search MIISMIAAMANNRVIGKENQMPWHLPADFAWFKRCTLGKPIIMGRKTFESIGKALPGRQN IVITRNPQFHADGVDVTDSLENALTLAGEVDEVMIIGGGSIYQAGLPLASRLYLTYIQAE IDGDTRFPDIGTEWHETYREAYSQDEKNAYDMSFVILEHSHE NT seq 489 nt NT seq  +upstreamnt  +downstreamnt atgattatcagtatgattgcagcgatggcgaataaccgggtgattggtaaagaaaaccaa atgccttggcacctgccggcagattttgcctggtttaaacgttgtacgctaggcaaacct atcatcatgggaagaaaaactttcgagtcgattggtaaggcgcttcccgggcggcaaaac atcgtcatcactcgcaaccctcagtttcacgcagacggggtcgatgtaactgactcgctt gaaaatgcattgacgctggcaggcgaggtggatgaggttatgatcatcggcgggggaagt atttatcaggcgggtttaccgctggcttcaaggttatatctcacctatattcaggctgaa attgacggggacacccgttttccggatatcggtactgaatggcatgagacttatcgggaa gcgtattcccaagatgagaaaaatgcttatgacatgtcatttgtaatactagagcatagt catgaatga

DBGET integrated database retrieval system