KEGG   Vibrio spartinae: Vspart_01682
Entry
Vspart_01682      CDS       T07037                                 
Symbol
pigE
Name
(GenBank) Aminotransferase PigE
  KO
K21778  3-acetyloctanal aminotransferase [EC:2.6.1.-]
Organism
vsr  Vibrio spartinae
Pathway
vsr00333  Prodigiosin biosynthesis
vsr01100  Metabolic pathways
vsr01110  Biosynthesis of secondary metabolites
Module
vsr_M00837  Prodigiosin biosynthesis, L-proline => prodigiosin
Brite
KEGG Orthology (KO) [BR:vsr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    Vspart_01682 (pigE)
Enzymes [BR:vsr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.-
     Vspart_01682 (pigE)
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2 Shikimate_DH
Other DBs
NCBI-ProteinID: QMV14427
UniProt: A0A7D8B1T6
LinkDB
Position
1:1874864..1877419
AA seq 851 aa
MKFGFIAHPTSVGLKRYVKMLDLLQRSSNELHSGYSRELWHKENLVPFMNFARITSATGA
TCEGIIRYMPLVADEMLAEPRVIAQRVIQGIEELVDEGAELVGLGGFTSIVGRRGEATAE
KSPVPVTSGNSLTTYAGYRALRQITEWLDINPEKEPIAIVGYPGSICLALSRLLLAEGYS
LYLLHRASHKDQAELLSHLPEQYHHRVTLTGDPETLYQSCRLFAGATSSGGIIETARLQP
GSIFIDIALPRDVDTEVRPQREDILIIDGGCVTATDAVKLGGESLNVTIKQQLNGCMAET
IVLALEGRREKFSLGRYLPPEKVLEIGEIAERHGFYAYPLASFGERLERQQVTNLKRYYH
HDIYENSTATSSSAQLAFIDGLLSQDAEREDTLDRYRQYVNPMMVDFLRLQHCDNVFQRA
SGTTLWTADGTAFLDMVAGYGCLSLGHNPQPVVNALKDYLDAQGPNFIQYISIPEQTAKL
AELLCYLSPGNMGRVFFSNSGTEAVEAAIKIAKASTGKPGIAYINNSYHGKTLGALSLTG
RDKHRRYFQPLLENMVEVPFADPEALEAAIRRDDVGALILEPIQGEGGVHLFPEGYLQRA
QQLCRETGTLLMMDEVQTGLARTGKLFACEWDNLEPDVMILSKSLSGGLVPIGATLCRAD
IWQQAYGTADRFLVHSSTFGGGNVASVVALSALRELIAQDLPARSARSGQYLKQALEEIA
AQYPFIKEIRGRGLMLGIQFEQSFAGAVAASAREFATRLPGDWHTTWKFLPDPVREHLQI
AMTRMEQSLGEMFCMKFVTKLCLDHNILTFITANSSTVIRIQPPLIIEQEEMERFVAAFA
DVCEELSTFMD
NT seq 2556 nt   +upstreamnt  +downstreamnt
atgaagttcgggttcattgctcatccaacatctgttggtttaaaacgttatgtcaaaatg
ctggatctgcttcagcgtagttcgaatgaactccacagtggttacagccgagagttatgg
cataaagaaaatctcgtgccatttatgaactttgcccggatcacatccgcaaccggggca
acatgtgaagggattattcgttatatgccgttggttgctgacgaaatgttggctgaaccg
cgtgtcatcgcacaacgggtaattcagggcatagaagagctagttgacgagggggctgag
ctggtcggtctgggcggatttacttcgattgtcggacgacgcggagaagccaccgctgaa
aaatcaccggtaccggtgacatcagggaattcactgacaacatacgcgggttaccgtgca
ctacgccagattacagaatggctggatatcaatccggaaaaagaaccgattgccattgtc
ggttatcccggctcgatctgtctggctttgagtcggctcttgttggcagaaggttattca
ctttacctactgcatcgtgccagccataaagatcaggctgaattgctcagtcatttgccg
gaacagtatcaccaccgtgtcacgttaaccggagacccggagacgctctaccagtcatgc
cgtttatttgcgggagcaacctcttccggtggcattatcgaaaccgctcgtcttcaaccc
ggttcaatctttattgatatcgcactcccccgggatgtcgataccgaagtacgccctcag
cgagaagatattctgatcatcgacggcggctgtgtcacagcgaccgatgccgtcaaactc
ggtggcgagtcattgaacgtaaccatcaagcaacagttaaatggctgtatggccgaaacc
atcgttttggctttagagggccggcgtgaaaaattctcgttaggtcgctatctgccaccg
gaaaaagtgcttgagatcggcgaaattgcagaaagacacggcttctatgcctacccgctc
gcctctttcggagagcgactcgagcgccaacaggtcacaaacctcaaacgctattatcac
catgatatttacgagaacagcactgcgacctcctcgtctgctcagttagctttcattgat
gggctgctcagtcaggatgccgaacgtgaagacacactggatcgttaccgtcagtatgtg
aatccaatgatggttgattttcttcgtctacagcattgcgacaatgtgttccaacgtgca
tccgggacaacattatggacggcagacggcaccgcctttctggatatggttgcgggatat
ggttgtctgagtctcggtcacaaccctcagcccgtggtgaacgcattgaaagattacctc
gatgcacaagggcccaacttcattcaatatatttcgatcccggaacagaccgcaaaactc
gcggagctgctgtgttacctctccccgggaaacatgggccgggtctttttcagtaactca
ggcactgaagctgtcgaagcggcaatcaaaattgcgaaagcatcgacgggcaaaccggga
attgcgtatatcaacaacagttatcacggtaaaacactcggtgcgctctcactcaccggt
cgcgataaacaccgtcgttatttccagccgctgttagaaaacatggtggaagtccccttc
gcagatccagaagcattagaagccgcaatccgacgtgatgatgtcggggcgctgatcctt
gaacctattcagggagaaggcggtgtgcatctcttccccgaaggttatctgcaacgcgct
cagcaactatgccgggaaaccggaacactgctcatgatggacgaagttcagaccgggctc
gctcgcaccggaaaactgttcgcttgtgagtgggacaacctagagccggatgtcatgatc
ctatcgaaatctctttccggaggtttggttccgattggtgcaaccttgtgccgtgctgat
atctggcaacaagcctatggcacggcggatcgttttctggttcatagttcaacattcggt
ggcggtaacgttgcctcggtggttgccctgagtgcgttgcgagaattaattgcccaagat
ttgccggcacgctcagctcgctctggtcaatatctcaagcaagccttggaagagatagcc
gcgcaatatccgtttatcaaggaaattcgcgggcgtggactcatgctggggattcagttc
gagcaatcttttgccggagcggttgcggcatcggctcgtgaatttgcgacacgcctgcct
ggtgactggcacaccacatggaagttcttaccggatccggtccgtgaacacctccaaatt
gccatgacgcgtatggagcaatcactgggtgaaatgttctgtatgaaatttgtcaccaag
ttatgtctggatcacaacattctgacatttatcaccgctaacagctcaaccgtgattcgt
attcaaccaccgttgattattgaacaggaagagatggaacggtttgtggctgcgtttgct
gatgtctgtgaagaactctcgacatttatggactga

DBGET integrated database retrieval system