Vitis vinifera (wine grape): 100255097 Help Entry 100255097         CDS       T01084                                  Name (RefSeq) calcium-binding protein CP1   KO K02183   calmodulin Organism vvi  Vitis vinifera (wine grape) Pathway vvi04016   MAPK signaling pathway - plant vvi04070   Phosphatidylinositol signaling system vvi04075   Plant hormone signal transduction vvi04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:vvi00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     100255097    04070 Phosphatidylinositol signaling system     100255097    04075 Plant hormone signal transduction     100255097  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     100255097  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:vvi01009]     100255097   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:vvi04131]     100255097    03036 Chromosome and associated proteins [BR:vvi03036]     100255097   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:vvi04147]     100255097 Protein phosphatases and associated proteins [BR:vvi01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      100255097 Membrane trafficking [BR:vvi04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     100255097 Chromosome and associated proteins [BR:vvi03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      100255097 Exosome [BR:vvi04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    100255097 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 AIF-1 Motif Other DBs NCBI-GeneID:  100255097 NCBI-ProteinID:  XP_010649593 LinkDB All DBs Position 5:<1748111..1748488 Genome browser AA seq 125 aa AA seqDB search RSFYVGFPSGVSGDEEAIGSMMSVADSNKDGFVGYDEFEHVLGCRRSPRNKGHGVAGVME DVCKVMDRDGDGKVGLEDLKSYMNWAGFSATEEEIKAMIKLGGGDEDSGVSYDGLLKILA VDYVN NT seq 378 nt NT seq  +upstreamnt  +downstreamnt cgcagcttttacgtgggattcccaagcggcgtctccggagatgaggaggcgatcgggtcg atgatgtcggtggcggattcgaataaggatgggtttgtggggtacgatgagtttgaacac gtgttgggctgccggagaagtccgaggaacaagggccacggcgtcgctggggtgatggag gatgtgtgtaaggttatggacagggacggcgacggcaaagtagggctcgaggatttgaag agctatatgaattgggccgggttttctgcaactgaggaagaaatcaaggccatgatcaaa ttgggcggcggtgatgaagatagtggtgtatcctatgatggtttgctcaagatcctggcc gttgattatgttaactaa

DBGET integrated database retrieval system