KEGG   Vibrio vulnificus MO6-24/O: VVMO6_02799
Entry
VVMO6_02799       CDS       T01415                                 
Name
(GenBank) legionaminic acid cytidylyltransferase
  KO
K24307  5-N-acetyl-7-N-(D-alanyl)-legionaminic acid cytidylyltransferase
Organism
vvm  Vibrio vulnificus MO6-24/O
Pathway
vvm00541  O-Antigen nucleotide sugar biosynthesis
vvm01100  Metabolic pathways
vvm01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:vvm00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    VVMO6_02799
SSDB
Motif
Pfam: CTP_transf_3 IspD NTP_transf_3 UvrD_C_2 Glyco_trans_4_4
Other DBs
NCBI-ProteinID: ADV87821
LinkDB
Position
I:complement(2999423..3000124)
AA seq 233 aa
MKILAITPARGGSKRLPGKNIKNLNGKPLIQWTIDAALAVQEIARVMVTTDCDEIAEIAK
KAGAEVPFIRPPELATDTSSSSDVIRHALDFYRAQGEEFDFVLLLQPTSPIRSADDIRHA
IEQLIAHTADAVVSVCPCDHSPLWANTLPDDRSMADFIRHEVSQLRSQDLPDYYRINGAI
YLTRVSRFYQENSLFLSSNIFAYVMDNESSVDIDHELDFLIAETVLKYREQNA
NT seq 702 nt   +upstreamnt  +downstreamnt
atgaaaatactggcgattactcctgcccgcgggggcagcaagcggctaccaggcaagaac
atcaaaaatttaaatggtaagcctctaatccaatggacaatagatgccgccttagcggtg
caagagatcgctcgcgtcatggtgacgacggactgtgacgagattgcggagattgcgaaa
aaagcgggggcagaggtgccgtttatccgcccaccagagttagccaccgacaccagttcc
agttccgatgtgatccgtcatgcgctggatttttatcgcgcacaaggtgaagagtttgat
tttgtcttactgttacaacccacgtcaccaattcgcagtgcggatgacatccgccacgcg
atcgagcaacttatagcgcatacggcggatgccgtcgtgtcagtgtgcccttgtgatcac
tcgccactttgggctaataccttaccagacgatcgctcgatggccgattttatccgtcat
gaagttagccagttgagaagtcaggatcttcctgattactatcgaattaatggtgcaatc
tacttaacaagagtgagcagattctaccaagaaaactcgctattcttatcttcaaacata
tttgcctatgtaatggataatgaaagctcggttgatattgaccatgagttggattttctg
attgcagaaacggtattaaaatatagggaacaaaatgcataa

DBGET integrated database retrieval system